Arya Sri Lalitavistarah Maha Vaipulya Dharmaparyaya Suttram

Halaman 2 dari 2 Previous  1, 2

Topik sebelumnya Topik selanjutnya Go down

Om AH hUM

Post by skipper on Tue Jan 19, 2016 10:20 pm


Muni Bhaisajya Raja


Muni Vaidya Raja

Bab 23 - Pemuliaan
samstavaparivartastrayovimśah

Kemudian para devaputrā dari kediaman śuddhāvāsa mengelilingi sang Tathāgata, yang duduk di kursi kebangkitan. Mereka menghujani Dia dengan hujan dari bubuk cendana surga dan memuji-Nya dengan syair gāthā yang tepat:

"Anda adalah cahaya yang telah terbit di atas dunia ini!
Sang Penguasa Dunia (lokanāthah) yang memancarkan cahaya,
Untuk dunia yang buta ini (andhabhūtasya lokasya),
Anda telah memberikan mata untuk meninggalkan penderitaan (caksurdātā ranamjaha).

"Anda menang dalam pertempuran!
Melalui kebajikan Anda telah memenuhi tujuan Anda!
Dipenuhi dengan kualitas-kualitas kebajikan,
Anda akan memuaskan para makhluk!

"Tiada kesalahan, Anda telah menyeberangi lumpur
Dan berdiri di atas tanah yang kering, Gautama !
Anda akan menyeberangkan makhluk hidup lainnya,
Yang terbawa oleh arus deras!

"'Wawasan besar Anda meninggikan Anda (udgatastvam mahāprāj˝o)!
Anda tiada bandingan di seluruh dunia (lokesvapratipudgalah)!
Anda tidak ternoda oleh urusan duniawi,
Seperti bunga teratai yang mengapung di atas air!

"Dengan obor wawasan Anda,
Anda dapat membangkitkan
Dunia yang lama tertidur ini,
Yang diselimuti oleh kabut kegelapan!

"Kedalam dunia kehidupan (cirāture jīvaloke),
Yang terus-menerus dipersulit dengan penyakit dari penderitaan,
Anda telah datang, Raja Penyembuh,
Untuk menyembuhkan dunia dari semua penyakit!

"Sekarang bahwa Anda telah muncul, Natha,
Keadaan-keadaan malang akan menjadi kosong!
Dewa dan manusia
Akan menjadi terisi dengan kebahagiaan (bhavisyanti sukhānvitāh)!

"Mereka yang berusaha untuk melihat Anda,
Sang Banteng di antara makhluk (purusarsabha),
Selama ribuan kalpa (kalpasahasrāni),
Tidak akan pernah pergi ke alam rendah (jātu yāsyanti durgatim).

"Mereka yang mendengarkan Dharma
Akan menjadi panditā dan bebas dari penyakit.
Mereka akan mendalam dan mengakhiri kumpulan,
Dan terbebas dari rasa takut!

"Ketika mereka memutuskan belenggu penderitaan itu,
Mereka semua akan terbebas dari kemelekatan
Dan cepat menjadi terbebaskan,
Dan dengan demikian mencapai buah hasil dari kebajikan tertinggi (yāsyanti nirupādānāh phalaprāptivaram śubham)!

"Mereka akan menjadi Objek dari kemurahan hati di dunia,
Layak menerima pemberian !
Sumbangan kepada mereka tidak akan berkurang,
Tapi menjadi penyebab bagi semua makhluk untuk mencapai nirvāna! "

Para Bhikshu, setelah para devaputrā dari kediaman śuddhāvāsa memuji sang Tathāgata dalam cara ini, mereka bersujud kepada sang Tathāgata dengan telapak tangan bergabung beranjali dan berdiri di satu sisi.

Para Bhikshu, kemudian para devaputrā dari ābhāsvarā memuja sang Tathāgata yang sedang duduk di kursi kebangkitan dengan sejumlah bunga, dupa, wewangian, karangan bunga, salap, payung, panji, dan bendera. Ketika persembahan telah dibuat, mereka berputar mengelilingi Dia tiga kali (tripradaksinīkrtya) dan kemudian memuji-Nya dengan syair gāthā ini:

"Pikiran Anda mendalam (gambhīrabuddhe), dan suara Anda manis (madhurasvarā), Muni ;
O Muni, suara Anda yang seperti lagu adalah merdu seperti suara Brahma.
Anda telah menemukan 'kebangkitan mutlak (varāgrabodhi)', yang paling luhur (paramārthaprāptā)!
Terpujilah Anda, yang telah mencapai puncak dari semua lagu-lagu merdu!

"Anda adalah Perlindungan, sebuah Pulau (dvīpo), Tujuan Tertinggi,
Sang Penguasa dunia yang penuh belas kasih (nātho'si loke krpamaitracittah)!
Anda adalah sang Penyembuh tertinggi, pencabut duri (vaidyottamastvam khalu śalyahartā)!
Anda adalah sang Penyembuh yang membawa manfaat luhur!

"Segera setelah Anda melihat Dīpamkara Buddha,
Anda mencapai kumpulan besar awan dari cinta kasih dan belas kasih.
Nāthā, turunkanlah hujan deras dari nektar!
Padamkan siksaan dewa dan manusia!

"Anda seperti bunga teratai, tidak ternoda oleh tiga dunia (tvam padmabhūtam tribhavesvaliptam)!
Anda seperti Meru, tidak bergerak dan tidak tergoyahkan (tvam merukalpo vicalo hyakampyam)!
Janji Anda tidak tergoyahkan seperti Vajra (tvam vajrakalpo hyacalapratij˝a)!
Anda seperti bulan dipenuhi dengan yang terbaik dari semua kualitas (tvam candramā sarvagunāgradhārī)!"

Para Bhikshu, setelah para devaputrā dari ābhāsvarā memuji sang Tathāgata begitu, mereka membungkuk kepada-Nya dengan telapak tangan bergabung beranjali dan berdiri di satu sisi.

Kemudian para dewa dari alam Brahma (brahmakāyikā devā), yang dipimpin oleh Subrahma devaputra, menutupi sang Tathāgata yang sedang duduk di kursi kebangkitan dengan jaring permata yang bertatahkan dengan banyak triliunan permata (bodhimandanisannamanekamaniratnakotīnayutaśatasahasrapratyuptena ratnajālenābhichādya). Mereka berputar mengelilingi Dia tiga kali (tripradaksinīkrtya), kemudian memuji-Nya dengan syair-gāthā yang tepat:

"Dengan 'wawasan yang berkebajikan dan yang tanpa noda (śubhavimalapraj˝a)', Anda berkilauan dan bersinar (prabhatejadharā).
Anda memiliki tiga puluh dua ciri-ciri yang paling luhur (dbātrimśallaksanavarāgradharā);
Penuh perhatian dan cerdas (smrtimam matimam), Anda memiliki kebijaksanaan yang berkebajikan (gunaj˝ānadharā).
Yang tidak kenal lelah, kami bersujud kepada Anda (akilāntakā śirasi vandami te).

"Benar-benar tanpa tiga noda, Anda suci dan murni.
Terkenal di seluruh tiga dunia (trailokyaviśruta), sang Penemu pengetahuan tiga kali lipat (trividyagatā),
Anda menganugerahkan wawasan kedalam pembebasan tiga kali lipat (trividhāvimoksavaracaksudadā).
Kami membungkuk kepada Anda yang memiliki tiga mata murni.

"Anda telah membuang jaman busuk yang gelap ini, Anda yang dengan pikiran terkendali dengan baik;
Dimuliakan dalam kasih sayang dan cinta kasih, Anda bekerja demi kesejahteraan makhluk.
Muni yang ditinggikan dalam kegembiraan, pikiran Anda hening-tenang;
Terbebas dari keraguan (dvayamativimocaka), Anda senang dalam keseimbangan (upeksaratā).

"Dimuliakan dalam disiplin dan pertapaan, Anda bertindak demi kesejahteraan makhluk;
Setelah memurnikan perilaku Diri sendiri, Anda telah mencapai puncak dari perilaku (svacarīviśuddhacaripāragatā).
Sebagai guru dari empat kebenaran (catusatyadarśaka), Anda senang dalam pembebasan (vimoksaratā);
Dengan membebaskan diri sendiri, Anda membebaskan makhluk lain juga.

"Saat yang kuat dan gigih, si Namuci tiba,
Dengan wawasan, ketekunan, dan cinta kasih, Anda mengalahkan dia
Dan kemudian Anda mencapai 'keadaan tertinggi yang abadi (padavaram amrtam)'.
Sang Pemenang atas gerombolan penjahat, kepada Anda kami memberi penghormatan!"

Para Bhikshu, setelah para dewa dari alam Brahma, yang dipimpin oleh Subrahma devaputra, telah memuji sang Tathāgata dengan syair-gāthā ini, mereka membungkuk kepada-Nya dengan telapak tangan bergabung beranjali dan berdiri di satu sisi.

Kemudian mereka anak-anak Mara yang berada di sisi kebenaran (śuklapāksikā māraputrā) mendekati sang Tathāgata dan menutupi Dia dengan payung permata besar dan kanopi (mahāratnachatravitāna). Kemudian dengan telapak tangan bergabung beranjali, mereka memuji sang Tathāgata dengan syair-gāthā yang tepat:

"Ketika kami, tentara Mara yang mengerikan, muncul dihadapan Anda,
Dalam kekuasaan Anda yang besar (mahāpratibhayā), Anda dengan sekejap mengalahkan gerombolan kami para Mara yang menakutkan,
Tanpa bangun, bergerak, atau mengucapkan sepatah kata pun.
Orang Bijak Yang Mencapai Segala Tujuan (sarvārthasiddham munim) dan yang disembah semua dunia (sarvalokamahitam), kepada Anda kami memberi penghormatan (tvām vandāmahi)!

"Triliunan Mara yang banyaknya sama seperti butiran pasir di sungai Gangga (mārā kotisahasranekanayutā gangānubhih sammitāh),
Tidak bisa memindahkan atau menggoncang Anda dari badan Pohon Bodhi yang luhur;
Mereka membuat triliunan persembahan kepada Anda, sebanyak butiran pasir di sungai Gangga.
Itulah sebabnya, Anda yang duduk di sini hari ini di badan Pohon Bodhi, bersinar!

"Saat mengejar 'pelaksanaan kebangkitan tertinggi (varabodhicarya)',
Anda menyerahkan istri tersayang, anak tercinta, pembantu, kebun, kota-kota,
kota, kerajaan, selir, dan gajah Anda,
Kepala, mata, lidah, dan kaki Anda - itulah sebabnya Anda bersinar hari ini!

"'Sebagai Buddha, yang mengenakan baju besi dari konsentrasi, kekuatan ajaib, dan kecerdasan,
Saya sendiri akan mengangkut seluruh triliunan makhluk, yang hanyut dalam lautan penderitaan,
Dalam kapal Dharma yang luhur (saddharmanāvā). "Cita-cita (pranidhi) ini yang berulang kali Anda ucapkan
Sekarang terpenuhi, dan Anda akan membebaskan semua makhluk!

"Dengan kebaikan dari memuji Anda, sang Pembicara Yang Paling Terkenal (vādivrsabham), yang memberi mata kepada dunia,
Semoga kami semua bersukacita, bercita-cita untuk 'kemahatahuan (sarvaj˝atām)' !
Saat kami mencapai kebangkitan luhur tiada tara (varāgrabodhimatulām) yang semua Buddha memuji,
Semoga kami mengalahkan gerombolan Mara dan membangkitkan kemahatahuan! "

Para Bhikshu, setelah para māraputrā, telah memuji sang Tathāgata dengan cara ini, dengan telapak tangan bergabung beranjali mereka membungkuk kepada-Nya dan berdiri di satu sisi.

Kemudian dewaputra dari Surga Paranirmitavaśavartī, dikelilingi dan dikawal oleh jutaan devaputra, menaburi sang Tathāgata dengan bunga teratai emas dari Sungai Jambu. Kemudian, dalam kehadiran-Nya, mereka memuji Dia dengan syair-gāthā ini:

"Pidato Anda adalah lembut, tenang, dan terus terang;
Bebas dari noda kegelapan (apagatatamaraja), Anda telah menyadari keadaan abadi (amrtagatigatā).
Anda layak menerima pelayanan yang tidak tertandingi di surga dan di bumi;
Kecerdasan Anda menyala - untuk Anda kami membungkuk!

"Anda membawa sukacita dan telah meninggalkan penderitaan dan melenyapkan kotoran dan noda;
Dengan pidato yang menggembirakan, Anda menyenangkan para sura dan manusia!
Dengan sinar cahaya dari Tubuh luhur yang tanpa noda dan berkilauan milik Anda,
Anda menang atas jagatraya ini, seperti 'Tuan untuk dewa dan manusia (suranarapatiriva)'!

"Pemenang atas lawan, Anda memiliki pengetahuan dalam perilaku orang lain;
Dicintai di dunia dewa dan manusia, Anda menggulingkan pikiran orang lain;
Yang Cemerlang dan Yang Bijaksana, Anda menerangi perilaku orang lain.
Berjalan di sini di jalan ini yang dilalui oleh Mereka Yang Memiliki 'sepuluh kekuatan (daśabala)'!

"Setelah melepaskan kemelekatan yang ada di mana-mana pada keberadaan, penderitaan yang salah ditafsirkan,
Semoga Anda melatih dewa dan manusia dengan melatih pikiran mereka.
Semoga Anda mengajar di langit diseluruh empat penjuru arah sama seperti bulan,
Dan menjadi mata luhur dan perlindungan akhir di dalam tiga dunia ini !

"Meskipun dicintai di dunia dewa dan manusia, Anda tidak tertarik pada objek indera;
Tanpa terlibat dalam nafsu keinginan, Anda mengambil kesenangan dalam kebajikan.
Diberitakan jauh dan luas, Anda adalah yang tanpa bandingan di tiga dunia;
Anda adalah Pelindung, Tempat Perlindungan, satu-satunya Tempat Peristirahatan makhluk di sini! "

Para Bhikshu, saat para dewaputra dari Surga Paranirmitavaśavartī, dipimpin oleh devaputrā yang bertanggung jawab, telah memuji sang Tathāgata, dengan telapak tangan bergabung beranjali mereka membungkuk kepada-Nya dan berdiri di satu sisi.

Berikutnya devaputra Sunirmita, dikelilingi dan dikawal oleh perkumpulan dewa dari Surga Nirmānaratī, menutupi sang Tathāgata dengan pita sutra yang bertaburan dengan berbagai batu permata, dan di hadapan-Nya memuji-Nya dengan syiar-gāthā ini:

"Anda adalah Cahaya Dharma yang telah muncul dari melepaskan tiga noda;
Anda menghancurkan khayalan, keyakinan salah, dan kebodohan (mohādrstiavidyaghātako), dan mengungkapkan kecemerlangan dan kemuliaan!
Anda menempatkan kedalam keadaan abadi mereka yang menikmati jalan yang salah!
Anda adalah objek pemujaan di sini di dunia, disembah di surga dan di bumi!

"Anda adalah Vaidya yang terampil dalam penyembuhan, yang membagi-bagikan obat mujarab kebahagiaan.
Melalui jalur dari para Pemenang sebelumnya, Anda membasmi semua penyakit dari makhluk,
Gejala yang mesih tetringgal dari keyakinan salah, penderitaan, dan kebodohan yang menumpuk.
Untuk alasan ini, Anda adalah Vaidyatamo dan Nāyakā yang mengajar di atas bumi.

"Sinar matahari, cahaya bulan, bintang, cahaya api, dan kilauan perhiasan,
Cahaya Sakra dan Brahma - tidak ada yang bersinar di hadapan kemegahan Anda!
Dengan wawasan Anda yang cemerlang dan bersinar, Anda dipenuhi dengan cahaya dan kemuliaan!
Untuk Anda yang kebijaksanaan yang luar biasa telah secara langsung diwujudkan, kami bersujud!

"Pembimbing Yang Sangat Mahir (vināyakā), yang berbicara merdu berhubungan apa yang benar dan tidak benar,
Yang memiliki pikiran yang lembut, tenang, dengan indera yang tenang, dan ketenangan yang besar,
Sang 'Guru (śāstā)' yang dapat mengajari para pendengar dari dewa dan manusia yang membutuhkan petunjuk,
Untuk Anda, Sākyamuni, sang Banteng di antara manusia (nararsabham), yang disembah oleh dewa dan manusia (suranaramahitam), kami memberi penghormatan!

"Dalam kecerdasan Anda, Anda memegang petunjuk kebijaksanaan menjadi yang tertinggi dan menyampaikannya di seluruh tiga keberadaan;
Anda menghapus tiga noda dan mengajarkan pengetahuan tiga kali lipat dan pembebasan tiga kali lipat.
O Muni, Anda memahami, sesuai dengan kecerdasan, yang merupakan bejana yang cocok dan yang tidak!
Untuk Anda, yang luar biasa di trisahasra (trisahasri adbhutah) dan yang disembah di surga dan di bumi (divi bhuvi mahitam), kami memberikan penghormatan!"

Para Bhikshu, saat devaputra Sunirmita, dan rombongannya, telah memuji sang Tathāgata, dengan telapak tangan bergabung beranjali mereka membungkuk kepada sang Tathāgata dan duduk di satu sisi.

Berikutnya devaputrah Samtusita, bersama dengan para dewa dari Surga Tusita (tusitakāyikairdevairyena), mendekati sang Tathāgata saat Dia duduk di kursi kebangkitan dan membungkus Dia dengan kain sulam besar dari pakaian surga. Kemudian Dia memuji sang Tathāgata di hadapan-Nya dengan syair-gāthā ini:

"Ketika Anda tinggal di surga Tusita, Anda mengajarkan Dharma dengan bebas.
Ajaran yang dari Anda terus berlanjut; bahkan hari ini para suraputrā mempraktekkan Dharma.
Kami tidak bisa mendapatkan cukup dari melihat Anda, dan tidak juga kami mendapatkan cukup dari mendengarkan Dharma;
Lautan Kualitas Yang Baik (gunasāgara), Lampu Dunia (lokapradīpā), untuk Anda kami membungkuk dengan kepala dan hati.

"Ketika Anda berangkat dari Surga Tusita, Anda menghabiskan semua keadaan yang tidak beruntung;
Kemudian, sambil duduk di pohon Bodhi, Anda memadamkan penderitaan semua makhluk.
Untuk mereka yang Anda menemukan kebangkitan besar dan mengalahkan Mara,
Dengan cita-cita Anda sekarang terpenuhi, cepat, putar Roda Dharma secara rinci!

"Ada banyak ribuan makhluk di seluruh sepuluh penjuru arah;
Biarlah Dharma terdengar oleh mereka yang mencarinya!
Semoga Anda segera memutar Roda secara rinci!
Semoga Anda membebaskan ribuan makhluk dari keberadaan! "

Para Bhikshu, saat para dewaputra Samtusita, dan rombongannya, telah memuji sang Tathāgata, dengan telapak tangan bergabung beranjali mereka membungkuk kepada-Nya dan berdiri di satu sisi.

Kemudian para dewa dari Surga Suyāma, yang dipimpin oleh dewa Suyama, pergi ke tempat dimana sang Tathāgata duduk. Ketika mereka tiba, mereka menyembah sang Tathāgata yang sedang duduk di kursi kebangkitan dengan sejumlah bunga, dupa, karangan bunga, wewangian, dan salep, dan dalam kehadiran-Nya mereka memuji-Nya dengan syair-gāthā yang tepat:

"Siapa yang lebih unggul pada Anda, Anda yang tanpa bandingannya
Dalam disiplin (śīla), penyerapan (samādhi), dan wawasan (praj˝a)?
Untuk Anda, Tathāgata, yang mahir dalam kecenderungan dan pembebasan (adhimuktivimuktikovidā),
Kami memberi penghormatan dengan kepala menunduk!

"Kami menyaksikan di kursi kebangkitan
Penampilan megah yang dilakukan oleh para dewa.
Bagaimana Anda disembah oleh dewa dan manusia!
Tidak ada orang lain yang layak untuk ini sama sekali!

"Ini tidaklah sia-sia bahwa Anda telah datang,
Menanggung kesulitan besar dalam proses.
Mengalahkan si jahat dan pasukannya
Kebangkitan tiada tandingan dicapai oleh Anda (prāptā bodhi anuttarā tvayā).

"Anda telah menerangi sepuluh penjuru arah,
Menerangi tiga dunia dengan pelita wawasan Anda.
Itu adalah Anda yang akan menghapus ketidakjelasan di dunia,
Melimpahkannya mata yang tiada tandingan (dāsyasi caksuranuttaram jage)!

"Memuji Anda selama banyak kalpa
Bahkan tidak akan menutupi pori-pori tubuh Anda.
Lautan Kualitas Yang Baik, yang terkenal di seluruh dunia, (gunasāgara lokaviśrutā)
Untuk Anda, Tathāgata, kami memberi penghormatan dengan kepala menunduk! "

Setelah para dewa dari Surga Suyāma, yang dipimpin oleh dewa Suyama, telah memuji sang Tathāgata, dengan telapak tangan bergabung beranjali mereka membungkuk kepada sang Tathāgata dan kemudian berdiri di satu sisi.

Kemudian Sakra devānāmindrah, bersama-sama dengan para dewa dari surga Trāyatrimśa, memuja sang Tathāgata dengan pertunjukkan dari bunga, dupa, karangan bunga, salap, payung, panji, dan bendera, kemudian memuji-Nya dengan syair-gāthā ini:

"Anda tidak terusik (askhalitā), tanpa kesalahan (anavadyā), dan sungguh stabil (sadā susthitā), seperti Gunung Meru (merukalpā), Muni !
Dengan kebajikan dan kemegahan, cahaya kebijaksanaan Anda terkenal di seluruh sepuluh penjuru arah!
Sebelumnya Anda telah memuja ratusan ribu Buddha, Muni. (buddhaśatasahasra sampūjitā pūrvi tubhyam mune)
Dan di tempat Mereka, Anda telah mengalahkan gerombolan Mara di pohon Bodhi!

"Sumber dari disiplin (śīla), belajar (śruta), penyerapan (samādhi), dan wawasan (praj˝ā), Anda adalah bendera kebijaksanaan (j˝ānaketudhvajā)!
Penghancur usia tua dan kematian (jaramarananighāti), Anda adalah Penyembuh tertinggi (vaidyottamā), yang memberikan mata untuk dunia (lokacaksurdadā)!
Setelah membuang tiga kekotoran batin dan cacat (trimalakhilaprahīna), indera Anda terkendali (śāntendriyā), pikiran Anda tenang (śāntacittā), Muni !
Untuk Anda, sang Banteng di antara suku Sakya (śākyarsabhā), sang Dharmarājā, kami datang berlindung!

"Usaha Anda untuk mencapai kebangkitan, dimuliakan oleh kekuatan ketekunan Anda, itu adalah tidak terbatas!
Kekuatan-kekuatan Anda, kekuatan wawasan (praj˝ābala), cara bijaksana yang terampil (upāya), kekuatan cinta kasih (maitrābalam), dan kekuatan jasa kebajikan brahma (brāhmapunyam balam) -
Sudah tidak terbatas, Sugata, ketika Anda berangkat untuk keadaan dari kebangkitan!
Dengan demikian memiliki kekuatan dari sepuluh kekuatan hari ini di kursi kebangkitan (daśabalabaladhārī adyā punarbodhimande bhuto)!

"Melihat gerombolan tentara yang tidak terbatas, para dewa menjadi cemas dan takut,
Jangan sampai sang Sramanarāju saat beristirahat di kursi kebangkitan menjadi terganggu.
Tetapi para makhluk itu tidak menakutkan Anda, dan tidak bisa pula mereka menggerakkan tubuh Anda;
Sebaliknya tangan Anda memukul keras, mengguncang mereka, dan Anda mengalahkan tentara Mara itu.

"Sama seperti Mereka yang sebelumnya mencapai kebangkitan luhur di atas takhta singa,
Anda telah mengikuti jejak Mereka; Anda terbangun dan menjadi sama dengan Mereka.
Sama persis dalam hati dan sama persis dalam pikiran (samamanasa samacitta), Anda telah mencapai kemahatahuan.
Dengan demikian, Yang Tertinggi Di Dunia (lokottamo), Yang Muncul Dengan Sendirinya (svayambhu), Anda adalah lapangan jasa kebajikan bagi makhluk (punyaksetram jage). "

Para Bhikshu, saat Sakra devānāmindrah, bersama-sama dengan para dewa dari surga Trāyatrimśa, telah memuji sang Tathāgata, dengan telapak tangan bergabung beranjali mereka membungkuk kepada sang Tathāgata dan duduk di satu sisi.

Berikutnya 'empat raja besar (catvāro mahārājānah)', bersama-sama dengan para devaputra dari Surga Caturmahārājakāyika, pergi ke tempat di mana sang Tathāgata berada. Ketika mereka tiba, mereka memuja-Nya. Ratusan ribu devaputra mengelilingi-Nya, memegang karangan bunga dan karangan bunga dari bunga ābhimuktaka, bunga Campaka, bunga melati (sumanā), bunga pala (vārsika), dan bunga dhānuskāri. Ratusan ribu 'gadis surga (apsarah)' mengelilingi-Nya, menyanyikan lagu-lagu surga (divyasamgītisampravāditena). Setelah itu mereka semua memuji sang Tathāgata dengan syair-gāthā yang tepat:

"Anda yang berpidato sangat merdu dan iramanya yang menawan,
Yang menenangkan dan berpikiran yang jelas seperti bulan,
Wajah yang tersenyum dan lidah yang panjang,
Untuk Anda, Muni Yang Paling Menawan (paramasuprītikarā mune), kami memberi penghormatan!

"Ketika pidato yang merdu dari Anda,
Suara yang begitu manis dan dicintai di antara dewa dan manusia,
Bergema di seluruh dunia,
Itu melampaui suara semua orang yang dapat berbicara!

"Itu mengakhiri penderitaan dari kemelekatan, kemarahan, dan kebodohan;
Ini menimbulkan sukacita yang murni dalam makhluk yang bukan manusia.
Setelah mendengar Dharma dengan hati yang tanpa noda,
Pembebasan Yang Mulia diperoleh mereka semua (ārya vimukti labhanti te hi sarve).

"Anda tidak meremehkan kebodohan,
Juga tidak pernah mabuk dengan kesombongan tentang pengetahuan Anda.
Anda tidak sombong maupun tidak segan-segan,
Seperti gunung yang kokoh di tengah lautan (giririva susthitu sāgarasya madhye).

"Orang-orang di sini telah memperoleh keuntungan dengan baik
Sejak Makhluk yang demikina itu telah muncul di dunia!
Seperti dewi kekayaan yang merupakan pemberi kekayaan,
Anda akan melimpahkan Dharma Anda di seluruh dunia! "

Setelah para dewa dari Surga Caturmahārājakāyika, dipimpin terutama oleh empat raja besar sendiri, telah memuji sang Tathāgata yang sedang beristirahat di kursi kebangkitan, mereka menggabungkan telapak tangan beranjali dan membungkuk kepada sang Tathāgata dan berdiri di satu sisi..

Kemudian para dewa dari langit (khalvantariksā devā) mendekati sang Tathāgata. Sebagai cara untuk memuja sang TathāgataYang Sempurna dan Yang Sepenuhnya Tercerahkan (tathāgatasyāntikamupasaṃkramyābhisambodheh pūjākarmane), para dewa menghiasi seluruh langit dengan jaring permata dan lonceng kecil. Mereka mempersembahkan payung permata, spanduk permata, permata dan karangan bunga dari kian sutra, menghias anting-anting permata, karangan kalung bunga, dan untaian mutiara dari berbagai jenis yang dimiliki oleh para dewa yang tampak di bagian atas tubuh mereka, serta bulan sabit. Setelah membuat persembahan ini, di hadapan-Nya mereka memuji-Nya dengan syair-gāthā ini:

"Tetap tinggal berdiam di langit, Muni,
Kami dengan jelas melihat semua kegiatan dari makhluk seperti apa adanya.
Melihat perilaku Anda, Suddhasattva,
Kami tidak melihat kebingungan dalam pikiran yang terfokus milik Anda.

"Langit dipenuhi dengan para Pembimbing manusia,
Para Bodhisattva yang telah datang untuk memberi persembahan.
Karena dalam cara ini tubuh Mereka adalah ruang angkasa,
Tidak ada timbul kerusakan pada rumah-rumah mewah surgawi.

"Meskipun hujan bunga,
Cukup untuk mengisi mahāsahasrā sampai penuh,
Turun ke atas tubuh Anda dari langit,
Mereka seperti sungai yang mengalir ke lautan.

"Kami melihat payung, bunga, anting-anting, dan karangan bunga,
Karangan bunga dari bunga Campaka,
Kalung, bulan, dan bulan sabit.
Para dewa menaburi Anda dengan itu, namun itu tidak bercampur bersama.

"Tidak ada ruang di sini bahkan untuk rambut (vālasya nābhūdavakāśamasmin)
Para dewa memenuhi seluruh langit (devaih sphutam sarvata antarīksam).
Mereka memberi puja kepada Anda, Yang Tertinggi Berkaki Dua (kurvanti pūjām dvipadottamasya),
Tapi Anda tidak bangga maupun tidak kewalahan. (na ca te mado jāyati vismayo vā)"

Setelah para dewa dari antarīksa telah begitu memuji sang Tathāgata yang sedang beristirahat di kursi kebangkitan, mereka menggabungkan telapak tangan beranjali dan membungkuk kepada-Nya dan berdiri di satu sisi..

Kemudian para dewa bumi (bhaumā devā), dalam rangka memuja sang Tathāgata, membersihkan dan mengurapi seluruh permukaan bumi, menaburi dengan air wangi, menaburi dengan bunga, menutupi dengan kanopi dari berbagai kain warna, dan kemudian mempersembahkan kepada sang Tathāgata. Setelah itu mereka memuji Dia dengan syair-gāthā ini:

"Trissahasrā telah menjadi tidak bisa dihancurkan dan sekeras Vajra.
Anda duduk di kursi kebangkitan melalui kebajikan dari posisi Vajra yang keras milik Anda ketika Anda mengatakan:
'Bahkan kulit, daging, tulang, dan sumsum Saya harus mengerut di sini,
Saya tidak akan bangkit dari tempat ini tanpa mencapai kebangkitan. '

"Jika Anda, Singa diantara laki-laki (narasimhā), tidak memberkati seluruh trissahasrā,
Maka semuanya akan runtuh
Dengan goncangan yang hebat dari kedatangan para Bodhisattva,
Telapak kaki dari Mereka akan menyebabkan gempa di sepuluh juta alam (yesa kramatalebhih kampitā ksetrakotyah).

"Sebuah hadiah yang terkenal diperoleh oleh para dewa bumi
Dimanapun sang Makhluk Tertinggi (paramasattva) pergi berjalan.
Selalu menerangi kegelapan di seluruh dunia;
Sekarang trisahasrah adalah dasar untuk pemujaan, berapa banyak lagi tubuh Anda?

"Kami akan memegang semua tanah trissahasrā -
Semua ratusan ribu yang sangat banyak air di bawah tanah,
Dan semua mata pencaharian yang sangat banyak dari para makhluk di tempat-tempat itu -
Kami akan mempersembahkan semua itu untuk Anda. Semoga Anda menggunakannya sesuai dengan keinginan Anda!

"Di mana pun Anda akan duduk, berjalan, atau istirahat,
Dan di mana pun para Srāvakā, yang adalah anak-anak yang terbahagiah (sugataputrāh) dari Gautama,
Akan memberitakan Dharma, atau di mana pun orang akan mendengarkan itu,
Kami mempersembahkan tempat-tempat itu, bersama dengan semua akar kebajikan (sarvakuśalamūlam), demi 'kebangkitan (bodhi)'! "

Setelah para bhaumā devā telah memuji dalam cara ini kepada sang Tathāgata yang sedang duduk beristirahat di bodhimanda, mereka membungkuk kepada-Nya dengan telapak tangan bergabung beranjali dan berdiri di satu sisi.

Demikianlah Sri Lalitavistara Bagian kedua puluh tiga tentang Pemuliaan.
(iti śrīlalitavistare samstavaparivarto nāma trayovimśatitamo'dhyāyah)


Terakhir diubah oleh skipper tanggal Wed Feb 10, 2016 8:46 pm, total 7 kali diubah

skipper

Jumlah posting : 439
Join date : 27.11.08
Age : 28

Lihat profil user http://aryamahayana.forumup.com

Kembali Ke Atas Go down

Namo Bhaisajye Guru Vaidurya Prabha Raja Tathagata Arhat SamyakSamBuddha

Post by skipper on Fri Jan 22, 2016 9:31 pm



namo ratna trayaya nama arya jnana sagara vairocana vyuha rajaya tathagataya arhate samyaksambuddhaya namah sarva
tathagatebhyah arhatebhyah samyaksambuddhebhyah nama arya avalokitesvaraya bodhisattvaya maha sattvaya maha karunikaya
tadyatha om dhara dhara dhiri dhiri dhuru dhuru itte we itte cale cale pracale pracale kusume kusuma vare ili mili cite jvalamapanaya svaha

trapusabhallikaparivartaścaturvimśah
Bab 24 - Trapusa dan Bhallika

Para Bhikshu, sementara sang Tathāgata sedang dipuji oleh para dewa setelah Dia mencapai Abhisambuddha, Dia menatap 'raja pohon (drumarāja)' tanpa berkedip dan tanpa keluar dari posisi duduk kaki bersila-Nya. Tujuh hari berlalu dengan cara ini ketika Dia berada di badan pohon Bodhi mengalami kebahagiaan dari makanan dari konsentrasi dan sukacita (dhyānaprītyāhārah sukhapratisamvedī).

Kemudian, setelah tujuh hari berlalu, para devaputrā dari alam nafsu keinginan (kāmāvacarā) mendekati sang Tathāgata, dengan membawa puluhan ribu vas berisi air wangi (daśagandhodakakumbhasahasrāni). Para devaputrā dari alam bentuk-rupa (rūpāvacarā) juga mendekati sang Tathāgata, dengan membawa puluhan ribu vas berisi air wangi. Ketika mereka tiba, mereka memandikan 'pohon Bodhi (bodhivrksam)' dan sang Tathāgata dengan air wangi. Yang sangat banyak tidak terhitung jumlahnya, para deva, nāga, yaksa, gandharvā, āsura, garuda, kinnara, mahoragā mengurapi tubuh mereka sendiri dengan air wangi yang bersentuhan dengan tubuh sang Tathāgata (tathāgatakāyapatitena). Ini menimbulkan diantara mereka niat pada Anuttarā Samyaksambodhau. Bahkan setelah para devaputrā itu dan yang lainnya telah kembali ke alam masing-masing, mereka tidak terpisah dari air wangi itu dan tidak menginginkan aroma lain. Melalui sukacita dan sukacita tertinggi yang lahir dari secara hormat membawa sang Tathāgata hingga ke hati, mereka menjadi 'yang tidak dapat diubah (āvaivartikā)' dari Anuttarā Samyaksambodheh.

Para Bhikshu, kemudian devaputra yang bernama Samantakusuma, yang telah bergabung dalam seluruh perkumpulan itu, bersujud ke kaki sang Tathāgata, dan dengan telapak tangan bergabung beranjali berkata kepada-Nya, "Bhagavan, apa nama dari Samādhi penyerapan di mana sang Tathāgata tetap selama tujuh hari tanpa bergerak dari posisi duduk kaki bersila?"

Para Bhikshu, dengan disapa demikian itu, sang Tathāgata berkata kepada devaputra itu berikut: "'Susunan Makanan Dari Sukacita (prītyāhāravyūho)', devaputra, adalah nama dari Samādhi penyerapan di mana sang Tathāgata tetap selama tujuh hari tanpa bergerak dari posisi duduk kaki bersila."

Para Bhikshu, devaputra Samantakusuma kemudian memuji sang Tathāgata dengan syair-gāthā ini:

"Kaki Anda ditutupi dengan roda kereta (rathacarananicitacaranā)
Dan bersinar dengan kecemerlangan bunga teratai ribuan kelopak yang tanpa noda (daśaśataarajalajakamaladalatejā).
Mahkota dewa menyentuh kaki Anda (suramukutaghrstacaranā);
Saya bersujud untuk kaki Anda, yang penuh dengan kemegahan (vande caranau śirighanasya) ! "

Ketika ia membungkuk ke kaki dari sang Sugata,
Pikiran suraputrah itu menjadi senang.
Ia mengatakan ini, yang menenangkan dewa dan manusia,
Dan menghapus keraguan mereka:

"Anda memberi kegembiraan kepada 'keluarga Sakya (śākyakula)',
Mengakhiri kemelekatan, kemarahan, dan kebodohan (antakarā rāgadosamohānām),
Membawa puncak dari semua keinginan;
Tolong hilangkan keraguan para dewa dan manusia.

"Anda telah mendapatkan 'kemahatahuan yang tidak terukur (sarvaj˝atāmaparimānām)',
Sang Buddha dengan sepuluh kekuatan (daśabalā buddhvā).
Jadi, Jinā, mengapa Anda tetap berada di tengah pusat bumi
Dalam 'gaya duduk bersila (bhindanti paryankam)' selama tujuh hari?

"Apa yang Anda tatap selama tujuh hari,
Dengan mata yang seperti bunga teratai seratus kelopak yang mekar
Saat Anda menatap, O Singa di antara Laki-laki (narasimhā),
Dengan mata yang tidak berkedip dan yang murni?

"Apakah itu 'cita-cita (pranidhī)' Anda
Yang membuat Anda tetap duduk bersila
Selama tujuh hari di Raja pohon?
Atau apakah itu adalah umum bagi semua 'Singa Yang Berbicara (vādisimhānām)'?

"Dengan gigi yang sangat rata dan murni,
Dan dengan nafas yang paling wangi dari Dia yang dengan sepuluh kekuatan,
Tolong berbicara kata-kata kebenaran yang murni,
Dan dengan demikian membawa sukacita kepada dewa dan manusia! "

Dia yang dengan wajah seperti bulan (candravadanah) menjawab:
"Dengar, apa yang Saya katakan, putra surga (śrnusva me bhāsato amaraputra)!
Saya akan memberikan secara singkat
Tanggapan terhadap pertanyaan-pertanyaan ini.

"Sama seperti seorang Raja yang tidak meninggalkan tempat
Di mana Dia di-abhiseka oleh kerabat-Nya
Selama rentan waktu tujuh hari,
Karena itu adalah kewajiban dari Raja,

"Begitu juga para 'Pemenang (Jinā)', bahkan dengan sepuluh kekuatan,
Ketika tersucikan, cita-cita Mereka terpenuhi,
Tetap berada dalam posisi duduk bersila
Di tengah pusat bumi selama tujuh hari.

"Sama seperti tatapan prajurit
Pada pasukan musuh yang dikalahkan,
Buddha juga, di kursi kebangkitan,
Menatap penderitaan yang sekarang dihancurkan.

"Kemelekatan dan kemarahan, yang lahir dari angan-angan khayalan,
Adalah seperti musuh makhluk.
Seperti pencuri dengan barang-barang yang dicuri,
Saya telah menghancurkan mereka di sini.

"Di sini Saya menghancurkan berbagai jenis bentuk dari kebanggaan
Dan kesombongan juga, sehingga mereka tidak ada lagi.
Saya melepaskan semua kekotoran batin,
Dan kebijaksanaan tertinggi telah terbit dalam diri Saya.

"Di sini ketidaktahuan yang mendorong rasa haus untuk keberadaan
Dan menyebabkan tindakan yang tidak pantas -
Jaringan dari akar termasuk pembentukan yang tersembunyi -
Hangus oleh api kebijaksanaan yang kuat.

"Di sini kepercayaan 'aku (aham)' dan 'milikku (mameti)'
Dan kekusutan kesalahannya,
Dengan akar yang membentang jauh, yang terikat ketat dengan rintangan,
Telah terputus dengan 'pisau kebijaksanaan (j˝ānaśastrena)'.

"Di sini mereka yang menderita penipuan dari 'milikku'
Telah pada akhirnya berakhir di kehancuran.
'Kumpulan (skandhāh)', bersama dengan kemelekatan kepadanya,
Saya telah melihat melalui kebijaksanaan Saya.

"Angan-angan khayalan yang mendua, perasaan mendalam yang keliru,
Yang akhirnya membawa orang ke neraka,
Saya telah menghapus di sini
Sehingga mereka pasti tidak pernah muncul lagi.

"Di sini adalah hutan rintangan
Yang telah terbakar habis oleh api dari akar kebajikan Saya.
Saya telah benar-benar menghanguskan
Kesalahpahaman empat kali lipat, juga.

"Karangan bunga yang berbahaya dari pikiran
Tergantung pada benang dari gagasan,
Saya telah benar-benar membalikkan
Dengan 'kalung mala (tasbih biji bodhi)' dari cabang kebangkitan.

"Enam puluh lima penderitaan (durgāni pa˝casasti),
Tiga puluh angan-angan khayalan yang tidak murni (mohānī trimśatim ca malināni),
Dan empat puluh kelakuan jahat (catvārimśadaghāni),
Saya lenyapkan di sini di tengah pusat bumi.

"Enam belas hal yang tidak terkendali (sodaśa asamvrtāni),
Delapan belas unsur (astādaśa dhātavaśca),
Dan dua puluh lima kesakitan (krcchrāni pa˝cavimśati),
Saya lenyapkan sambil duduk di tengah pusat bumi.

"Dua puluh arus gairah (vimśati rajastarāni)
Dan dua puluh delapan ketakutan makhluk (astāvimśati jagasya vitrāsāh),
Saya benar-benar melampaui (iha me samatikrāntā)
Melalui kekuatan dan tanggung jawab dari semangat-ketekunan Saya (vīryabalaparākramam karitvā).

"Demikian juga lima ratus auman dari para Buddha,
Saya sangat memahami di sini.
Gejala kejadian (dharmāna), seratus ribu yang kuat,
Saya juga sangat memahami.

"Di sini seluruh sembilan puluh delapan pembentukan tersembunyi,
Hingga ke bagian bawah akar mereka
Dan semua tunas kecambah mereka,
Hangus oleh api kebijaksanaan Saya.

"Waduk dari keraguan dan ketidakpastian,
Diisi dengan air dari pandangan
Dari sungai hasrat keinginan - sumber dari yang bukan kebajikan -
Dikeringkan oleh matahari kebijaksanaan Saya.

"Ketika Saya melepaskan Diri dari kepura-puraan dan tipu muslihat,
Di sini Saya menebang hutan penderitaan
Itu dipenuhi dengan penipuan, kekikiran, kebencian, dan kecemburuan,
Dan dihanguskan dengan 'api disiplin (vinayāgninā)' Saya.

"Di sini, melalui obat kebijaksanaan yang paling luhur,
Saya membersihkan diri sendiri dari akar perselisihan
Yang menyebabkan mual dari alam rendah -
Yakni, membuat ucapan yang menghina Aryā.

"Di sini Saya mencapai akhir dari semua tangisan,
ratapan, kesedihan, dan keluhan,
Setelah Saya mencapai
Penyerapan dan kualitas kelahiran dari kebijaksanaan.

"Di sini saya menang atas semua arus penderitaan yang menyiksa,
Dengan anak sungai dan tikungannya
Dari kesombongan dan kelalaian,
Setelah Saya mencapai 'penyerapan (samādhi)' yang selaras dengan kebenaran.

"Seluruh hutan lebat dari penderitaan,
Yang penuh dengan 'pohon-pohon keberadaan (bhavavrksāh)' dan ditumbuhi akar gagasan,
Saya menebang dengan 'kapak kesadaran (smrtiparaśunā)',
Dan menghanguskan dengan 'api kebijaksanaan (j˝ānāgninā)' Saya.

"Sama seperti yang Sakra lakukan pada penguasa Asura,
Di sini Saya menghancurkan dengan pedang kebijaksanaan,
Penipu yang terobsesi diri,
Cukup kuat untuk menguasai tiga alam.

"Di sini, di pusat bumi,
Saya memotong seluruh jerat dari tiga puluh enam jalan dari perbuatan.
Dengan pedang yang kuat dari wawasan,
Kemudian menghanguskannya dengan api kebijaksanaan.

"Di sini dengan 'mata bajak dari wawasan yang dalam (praj˝ābalalāngalamukhena)',
Saya mencabut semua akar penderitaan
Bersama dengan pembentukan terpendamnya,
Yang menghasilkan penderitaan dan kesedihan.

"Di sini Saya membersihkan mata kebijaksanaan,
Secara alami murni dalam semua makhluk.
Dengan salep besar dari wawasan,
Saya menghapus ketidakjelasan yang tebal dari angan-angan khayalan.

"Di sini, dengan sinar matahari dari kesadaran dan keheningan-tenang,
Saya mengeringkan lautan keberadaan (viśositā me bhavasamudrāh),
Hamparan dari hasrat keinginan yang bergejolak
Oleh buaya yang mabuk dari empat unsur fisik (caturo madamakaraviloditā).

"Di sini Saya memadamkan, dengan air dingin pembebasan,
Api besar dari nafsu berahi,
Dengan asap yang mengepul dari pikirannya
Mengamuk melalui benda-benda kayu.

"Di sini, dengan hembusan dari tekad yang dahsyat,
Saya mengusir dan membubarkan
Awan dari pembentukan tersembunyi,
Dengan petir dari kecenderungannya dan petir dari gagasannya.

"Di sini Saya mencapai penyerapan dari kesadaran murni (smrtivimalasamādhimāgamya)
Dan memukul jatuh dengan pukulan yang kuat dari pedang pengetahuan
Para musuh dari pikiran bergagasan dan tindakan,
Dan cara bermusuhannya yang memperkuat keberadaan.

"Di sini, setelah memperoleh cinta, Saya mengalahkan
Tentara dari gerombolan namuci yang gigih,
Dengan bentuk cacat, memikul puncak-puncak tertinggi,
Di atas kereta tempur yang perkasa dengan gajah dan kuda.

"Di sini Saya mengikat ke bawah
Kuda dari enam bidang indera,
Yang membesar dengan lima objek indera dan ceroboh dengan pemabukan,
Saat Saya mencapai penyerapan dari penolakan.

"Di sini Saya mencapai akhir
Dari keberahian dan penyerangan,
Kerja keras dari pertikaian dan perselisihan,
Saat Saya mencapai penyerapan dari tiada keinginan.

"Di sini Saya menghabiskan semua kesombongan,
Pikiran, dan gagasan,
Yang berakar di dalam diri Saya dan diluar,
Saat Saya mencapai penyerapan dari kekosongan.

"Di sini Saya melepaskan, tanpa kecuali,
Semua kenikmatan dewa dan manusia,
Sampai puncak keberadaan,
Saat Saya mencapai penyerapan dari tiada tanda.

"Di sini, saat Saya mencapai pembebasan tiga kali lipat,
Saya sepenuhnya membebaskan
Semua belenggu keberadaan
Melalui kekuatan pengetahuan Saya.

"Di sini, melalui menyaksikan sebab dan akibat,
Saya mengalahkan tiga gagasan sebab akibat:
Gagasan dari kekekalan dan ketidakkekalan,
Diri dan tiada diri, kesenangan dan kesakitan.

"Di sini, di badan dari raja pohon,
Saya memutuskan dengan pukulan dari ketidakkekalan
Hamparan dari karma yang berbeda-beda,
Semuanya tersapu bersih dalam enam bidang indera.

"Di sini, dengan matahari kebijaksanaan,
Saya menghilangkan kabut angan-angan khayalan yang terrendahkan dengan kotoran,
Tebal dengan pandangan dari kesombongan dan kemarahan,
Sehingga menerangi apa yang tergelapkan begitu lama.

"Di sini, dengan 'perahu dari semangat ketekunan (vīryabalanāvā)',
Menyeberangi Lautan besar samsara (samsārasāgaramaham samtīrno)
Dengan buayanya dari nafsu gairah dan keinginan,
Gelombangnya yang dari hasrat keinginan, dan cengkramannya pada pandangan salah.

"Di sini Saya terbangunkan pada keBuddhaan
Yang menghanguskan 'keinginan (rāga)', 'kebencian (dvesa)', 'angan-angan khayalan (mohāmśca)',
Dan gagasan pikiran (cittavitarkām),
Seperti belalang jatuh ke dalam kebakaran hutan.

"Tertindas begitu lama -
Selama miliaran kalpa yang tak terhitung jumlahnya -
Di jalan dari siklus keberadaan (samsārapathā),
Di sini Saya sadar, penderitaan Saya sekarang terpadamkan.

"Di sini saya telah mencapai 'nektar abadi (amrtam)',
Yang belum ditemukan oleh pembabar lain,
Yang mengakhiri usia tua, kematian, penderitaan, dan sakit
Untuk kepentingan dunia.

"Di sini Saya telah mencapai kota keberanian,
Di mana penderitaan yang lahir dari hasrat keinginan melalui pengalaman indera,
Dan penderitaan yang berdasarkan pada kumpulan (skandhairduhkham),
Tidak akan muncul lagi.

"Di sini Saya telah menyadari
Musuh besar yang di dalam, semua jumlah banyak mereka.
Setelah mengikat dan menghanguskan mereka,
Saya telah memastikan bahwa mereka tidak bisa lagi muncul.

"Di sini saya telah menyadari nektar abadi,
Demi itu yang
Saya menyerahkan daging saya sendiri, mata saya, dan banyak perhiasan berharga
Selama miliaran kalpa.

"Di sini Saya mengerti apa yang disadari
Oleh para Pemenang yang tidak terhitung di masa lalu,
Tentang yang manis dan kata-kata yang menyenangkan
Yang diumumkan di seluruh dunia.

"Di sini Saya menyadari (iha tanmayānubuddham)
Dunia yang muncul saling bergantungan adalah kosong (pratītyasamudāgatam jagacchūnyam),
Muncul terulang lagi di setiap saat pengartian (citteksane'nuyātam)
Seperti fatamorgana, atau kota gandharva (marīcigandharvapuratulyam).

"Di sini Saya telah memurnikan mata yang paling luhur
Dimana Saya melihat semua dunia,
Seperti buah ditempatkan
Di telapak tangan.

"Di sini Saya mengingat kembali kehidupan masa lampau saya.
Saya mencapai tiga pengetahuan,
Kemudian mengingat sangat banyak kalpa yang tidak terukur,
Seperti terbangun dari tidur.

"Apa yang membuat para sura dan manusia terbakar
Adalah kesalahpahaman mereka.
Namun di sini saya meminum obat mujarab dari nektar,
Benar-benar bebas dari kesalahan.

"Di sini, setelah menang melalui 'kekuatan cinta kasih (maitrībalena)',
Saya meminum obat mujarab dari nektar,
Demi itu yang
Para Pemilik sepuluh kekuatan telah mengolah cinta kasih untuk semua makhluk.

"Di sini, setelah menang melalui 'kekuatan belas kasihan (karunābalena)',
Saya meminum obat mujarab dari nektar,
Demi itu yang
Para Pemilik sepuluh kekuatan telah mengolah belas kasihan untuk semua makhluk.

"Di sini, setelah menang melalui 'kekuatan sukacita (muditābalena)',
Saya meminum obat mujarab dari nektar,
Demi itu yang
Para Pemilik sepuluh kekuatan telah mengolah sukacita untuk semua makhluk.

"Di sini, setelah menang melalui 'kekuatan ketidakberpihakan/keseimbangan batin (upeksabala)',
Saya meminum obat mujarab dari nektar,
Demi itu yang
Para Pemilik sepuluh kekuatan telah mengolah ketidakberpihakan selama kalpa yang sangat banyak.

"Di sini Saya meminum obat mujarab dari nektar
Yang telah diminum oleh Mereka yang memiliki sepuluh kekuatan,
Para Singa Pemenang masa lampau (prāgjinasimhaih pūrve),
Yang lebih banyak dari pasir di sungai Gangga.

"Kata-kata yang Saya katakan
Di depan Mara dan pasukannya adalah:
"Saya tidak akan keluar dari posisi duduk bersila
Sampai Saya mengakhiri usia tua dan kematian. '

"Saya menghancurkan ketidaktahuan
Dengan nyala kebijaksanaan yang sekeras Vajra,
Dan mencapai keadaan dari sepuluh kekuatan.
Itulah sebabnya Saya sekarang meninggalkan sikap duduk bersila.

"Saya mencapai tingkat ārahat,
Menghabiskan semua kekotoran batin Saya,
Dan menghancurkan gerombolan namuci.
Itulah sebabnya Saya sekarang keluar dari sikap duduk bersila.

"Di sini Saya membelah
Pintu yang tertutup dari lima rintangan
Dan memotong tanaman merambat dari hasrat keinginan.
Sekarang Saya keluar dari sikap duduk bersila. "

Kemudian sang Bulan ini di antara manusia (manusyacandrah)
Bangun perlahan dari tempat duduk-Nya,
Menerima upacara ābhīseka,
Dan mengambil tempat duduk di tathta yang unggul (bhadrāsane).

Perkumpulan sura, menggunakan kendi permata
Yang di isi dengan air wangi yang berbeda,
Memandikan 'sang Teman dunia (lokabandhum)',
Yang mencapai puncak dari kualitas dan sepuluh kekuatan (daśabalagunapāramiprāptam).

Miliaran dewa (devakotinayutāni),
Bersama dengan sangat banyak gadis surga,
Melakukan pemujaan yang beragam,
Dengan ribuan alat musik di sekeliling.

Devasutāh, itu adalah demikian
Wajar, masuk akal, dan beralasan yang baik
Mengapa para Jinā tidak meninggalkan posisi duduk bersila Mereka
Di pusat bumi selama tujuh hari.

Para Bhikshu, sang Abhisambuddhabodhistathāgatah duduk selama tujuh hari pertama pada tempat duduk itu, berpikir, "Di sini Saya telah mencapai ānuttarā samyaksambodhirabhisambuddhā. Di sini Saya mengakhiri penderitaan dari kelahiran yang tanpa awal, usia tua, dan kematian. "Selama minggu kedua, sang Tathāgata mengembara jauh dan luas di seluruh trisāhasramahāsāhasralokadhātu. Selama minggu ketiga, sang Tathāgata menatap kursi kebangkitan tanpa berkedip dan berpikir, "Di sini Saya mencapai ānuttarā samyaksambodhimabhisambudhy, mengakhiri penderitaan dari kelahiran yang tak berawal, usia tua, dan kematian." Kemudian, pada minggu keempat, sang Tathāgata berjalan, tapi tidak jauh, kali ini berjalan dari lautan timur ke lautan barat.

Kemudian Mara, si jahat, mendekati sang Tathāgata dan berkata, "Karena waktu sekarang telah tiba bagi sang Bhagavan untuk masuk ke Parinirvana, berangkatlah ke Parinirvana, Sugata! Berangkatlah ke Parinirvana, Bhagavatah!"

Para Bhikshu, ketika Dia mengatakan ini, sang Tathāgata menanggapi Mara, si jahat: "Pāpīyan, Saya tidak akan masuk ke Parinirvana sampai Bhikshu Sthavirā Saya telah menjadi terkendali, jernih, mahir, berani, dan terpelajar; Sampai Mereka telah memulai Dharma dengan cara yang asli dan menjadi 'Tuan atas diri mereka sendiri (svayamācāryakam)'; dan sampai Mereka bisa mengatasi lawan dalam kecocokan dengan Dharma dan mengajarkan Dharma bersama dengan keajaiban. Pāpīyan, Saya tidak akan berlalu ke Parinirvana sampai tradisi dari Buddha, ajaran-Nya, dan masyarakat-Nya mapan terdirikan di dunia; dan sampai para Bodhisattvā yang tidak terbatas jumlahnya diramalkan untuk mencapai anuttarā samyaksambodhau. Pāpīyān, Saya tidak akan meninggal dunia sampai keempat perkumpulan Saya menjadi terkendali, jernih, mahir, dan berani, dan dapat mengajarkan Dharma bersama dengan keajaiban."

Kemudian, segera setelah Mara Pāpīyān, mendengar kata-kata ini, ia melangkah ke samping dan berdiri di sana sedih dan tertekan. Sedih, dengan kepala menggantung rendah, ia menulis di tanah dengan tongkat: "Dia telah mengatasi kerajaan saya!"

Kemudian tiga putri Mara ini - Rati, Arati, dan Trsnā - berbicara syair-gātha ini untuk Mara, si jahat:

"Bapa, mengapa anda tidak bahagia?
Beritahu kami siapakah Orang ini!
Kami akan mengikat Dia dengan jerat nafsu keinginan
Dan mengiring Dia seperti gajah.

"Mengiring Dia, kami akan segera
Membawa Dia di bawah kendali anda.
Jadi buanglah suasana hati yang buruk!
Anda akan menjadi gembira. "

Mara, si jahat, mengatakan:

"Sugato adalah sang Arahan di dunia;
Dia tidak akan pernah jatuh di bawah kuasa nafsu keinginan.
Dia telah pergi jauh melampaui kerajaan saya;
Ini adalah mengapa saya berduka begitu kuat! "

Meskipun para gadis itu sudah mengalami perbuatan sang Bodhisattva dan kekuatan sang Tathāgata, dikarenakan oleh sifat yang berubah-rubah mereka, mereka tidak mendengarkan kata-kata Bapa mereka. Mereka berubah wujud menjadi gadis di usia muda terbaik, yang baru saja mencapai kedewasaan dan, untuk membingungkan sang Tathāgata, mereka pergi kehadapan Dia, menggunakan semua tipu daya perempuan mereka. Namun, saat sang Tathāgata tidak menghiraukan mereka, mereka berubah menjadi wanita tua jompo. Para gadis itu kemudian pergi kehadapan Bapa mereka dan mengatakan ini:

"Memang benar apa yang anda katakan, Bapa:
"Dia tidak terpengaruh oleh nafsu keinginan;
Dia telah pergi jauh melampaui kerajaan saya.
Ini adalah mengapa saya berduka begitu kuat! '

"Bentuk yang kami wujudkan untuk menghancurkan Gautama
Seharusnya telah mematahkan hati-Nya,
Namun Dia hanya melihatnya.
Bapa, tolong hilangkan badan-badan jompo kami ini. "

Mara, si jahat, mengatakan:

"Saya tidak mengetahui siapa pun di dunia kehidupan atau di dunia kematian
Yang bisa mengubah apa yang telah dilakukan oleh kekuatan Buddha.
Segera pergi dan mengakulah kepada sang Muni pelanggaran yang anda lakukan;
Dia kemudian akan mengembalikan tubuh anda ke bentuk sebelumnya yang anda inginkan. "

Jadi para perempuan itu pergi dan memohon sang Tathāgata untuk pengampunan, dengan mengatakan:

"Bhagavān, maafkan pelanggaran kami!
Sugato, maafkan pelanggaran kami,
Kami yang kekanak-kanakan, bodoh, tidak mengolah, tidak terampil, perempuan yang tidak tahu
Berbuat dengan keinginan untuk menghina sang Bhagavan! "

Kemudian sang Tathāgata berbicara kepada mereka dengan syair-gātha ini:

"Anda ingin mengikis menembus gunung dengan kuku jari,
Mengunyah seluruh besi dengan gigi anda,
Menembus gunung dengan kepala anda,
Dan mengukur kedalaman yang tidak dipahami.

"Jadi Saya memaafkan pelanggaran dari kalian. Kenapa begitu? Karena itu merupakan kemajuan dalam pelatihan Dharma Arya untuk memahami kesalahan menjadi kesalahan, mengakuinya, dan bersumpah untuk menjauhkan diri dari itu selanjutnya."


Para Bhikshu, selama minggu kelima, sang Tathāgata tinggal berdiam dalam wilayah Raja Naga Mucilinda. Karena cuaca minggu itu melewati batas, Raja Naga Mucilinda, khawatir bahwa tubuh sang Bhagavatah akan dibahayakan oleh dingin dan angin, keluar dari tempat tinggalnya, melingkarkan tubuhnya di sekitar sang Tathāgata tujuh kali, dan melindungi Dia dengan kerudungnya. Dari timur juga, beberapa lebih banyak Raja Naga tiba. Khawatir bahwa dingin dan angin akan membahayakan tubuh sang Bhagavatah, mereka juga melingkarkan tubuh mereka tujuh kali mengelilingi tubuh sang Tathāgata dan melindungi Dia dengan kerudungnya. Sama seperti Raja-Raja Naga dari timur, para Raja Naga dari selatan, barat, dan utara juga datang, khawatir bahwa dingin dan angin mungkin membahayakan tubuh sang Tathāgata. Mereka juga melingkarkan tubuh mereka mengelilingi tubuh sang Tathāgata tujuh kali dan melindung Dia dengan kerudung mereka. Tumpukan para Raja Naga itu menjulang di ketinggian seperti ketinggian Meru, sang raja pegunungan. Para Raja Naga itu tidak pernah sebelumnya mengenal kebahagiaan yang seperti selama tujuh hari tujuh malam itu, karena dekat dengan tubuh sang Tathāgata.

Ketika tujuh hari berlalu, para Raja Naga itu memahami bahwa cuaca buruk telah berlalu, dan sehingga mereka membentangkan tubuh mereka dari tubuh sang Tathāgata. Mereka kemudian menundukkan kepala mereka di kaki sang Tathāgata, mengelilingi Dia tiga kali, dan kembali ke rumah masing-masing. Raja Naga Mucilinda juga menundukkan kepalanya ke kaki sang Tathāgata, mengelilingi Dia tiga kali, dan kemudian berangkat ke wilayah-nya.

Selama minggu keenam, sang Tathāgata melanjutkan dari wilayah Raja Naga Mucilinda menuju ke 'pohon beringin (nyagrodha)' dari pengembala kambing. Dalam perjalanan, di tepi Sungai Nairanjana diantara wilayah Raja Naga Mucilinda dan pohon beringin dari pengembala kambing, sang Tathāgata telah terlihat oleh beberapa caraka, parivrājaka, vrddhaśrāvaka, gautama, nirgrantha, ājīvikā, dan lain-lain juga. Mereka bertanya, "Bhagavatā, apakah Gautama bepergian dengan bahagia selama tujuh hari musim badai tak menentu?"

Para Bhikshu, pada waktu itu sang Tathāgata berbicara kata-kata yang bermakna ini:

"Bahagia adalah kesendirian dari Dia yang puas yang telah mendengar Dharma dan bisa melihat (sukho vivekastustasya śrutadharmasya paśyatah).
Bahagia adalah ketiadaan dari cedera, di dunia ini, dari Dia yang 'mengendalikan diri (samyatah)' terhadap makhluk hidup.

"Bahagia adalah terbebas dari nafsu keinginan yang melampaui kejahatan.
Bahagia adalah penaklukan keegoisan dan kebanggaan. Ini sungguh adalah bentuk tertinggi dari kebahagiaan (paramam sukham)! "

Para Bhikshu, melihat dunia terbakar dengan kelahiran, usia tua, sakit, kematian, kesedihan, ratapan, penderitaan, ketidakpuasan, dan perselisihan, sang Tathāgata berikutnya mengucapkan kata-kata yang bermakna ini:

"Dunia ini tersiksa oleh suara (śabda), sentuhan (sparśa), rasa (rasa), bentuk (rūpa), dan bau (gandhaih).
Bahkan saat ketakutan oleh keberadaan, karena mendambakan keberadaan, para makhluk terus mengejar keberadaan. "

Selama minggu ketujuh, sang Tathāgata duduk di badan Pohon Bodhi. Selama waktu itu, dua pedagang bersaudara yang terpelajar dan pintar dari utara, Trapusa dan Bhallika, sedang bepergian kembali dari selatan, setelah banyak memperoleh keuntungan, dengan gerobak dari lima ratus kereta yang terisi penuh membawa berbagai jenis barang dagangan.

Mereka memiliki dua ekor banteng jantan yang bernama Sujata dan Kirti. Kedua ekor banteng ini tidak takut dihentikan, dan dengan demikian mereka bisa dipekerjakan di mana tidak ada banteng jantan lainnya akan lewat.
Di mana pun ada ancaman, mereka akan berdiri seolah-olah terikat ke tiang pancang. Mereka tidak bisa terpancing oleh cambuk, tetapi hanya dengan segenggam bunga teratai (utpalahastakena), atau karangan bunga melati (sumanādāmakena).

Ketika gerobak dari pedagang ini mendekati pohon Bodhi, devatā yang tinggal di hutan pohon susu menyulap semua kereta itu, sehingga membuatnya tidak bergerak. Semua bagian dari kereta itu, seperti perlengkapan hewan dan sisanya, robek dan pecah, dan roda kereta itu tenggelam ke dalam tanah hingga setinggi gandar rodanya. Bahkan dengan semua orang membuat usaha besar, gerobak itu tidak akan bergerak lebih jauh.

Terkejut dan ketakutan, para anggota gerobak itu berpikir, "Mengapa kereta berhenti di sini di dataran ini? Apa yang telah terjadi? "Mereka membawa keluar dua ekor banteng jantan Sujata dan Kirti, tetapi mereka juga tidak akan bergerak lebih jauh lagi, meskipun mereka terpancing dengan tandan bunga teratai dan karangan bunga melati. Kemudian pedagang-pedagang itu berpikir, "Karena bahkan kedua hewan ini tidak akan bergerak, pasti ada ancaman di depan. "

Sehingga mereka mengirim para pengintai di atas kuda. Ketika para pengintai itu kembali, mereka melaporkan, "Tidak ada ancaman apapun."

Devata itu kemudian menampakkan wujudnya dan menghibur para anggota gerobak itu, dengan mengatakan, "Jangan takut!" Sekarang dua ekor banteng jantan itu bisa memimpin gerobak-gerobak itu ke tempat sang Tathāgata berada.

Ketika mereka tiba, mereka melihat sang Tathāgata menyala seperti dewa api, indah terhiasi dengan tiga puluh dua tanda dari Makhluk Besar, bersinar dengan kemegahan, seperti matahari tepat setelah fajar.

Melihat Dia, para pedagang terkejut dan berpikir, "Apakah ini adalah Brahma yang telah datang ke sini? Ataukah itu Sakra sang raja para dewa? Ataukah itu Vaisravana, atau mungkinkah Sūrya atau Candra? Atau apakah itu Dewata gunung (giridevatam), atau Dewata sungai (nadīdevatam)? "

Sang Tathāgata kemudian menampakkan jubah kāsāyā-Nya (jubah berwarna kuning jingga), dan sehingga para pedagang itu mengatakan, "Orang ini dengan jubah kāsāyā-Nya adalah seorang Pravrajitah (Orang yang meninggalkan keduniawian), sehingga Dia bukan ancaman bagi kami." Mereka sesungguhnya telah mengembangkan pengabdian kepada-Nya, dan jadi mereka mengatakan di antara diri mereka sendiri, "Ini harusnya waktu makan untuk Pravrajitah ini. Makanan lezat apakah yang kami miliki? "

Beberapa anggota dari gerobak itu mengatakan, "Ada madu, bubur, dan tebu yang telah dikupas."

Jadi, dengan membawa madu, bubur, dan tebu yang telah dikupas, mereka pergi ke tempat sang Tathāgata duduk, membungkukkan kepala mereka ke kaki-Nya, berputar mengelilingi-Nya tiga kali, dan berdiri di satu sisi. Kemudian mereka berkata kepada sang Tathāgata: "Tolong perhatikan kami dengan kasih sayang dan terimalah derma ini! "

Para Bhikshu, sang Tathāgata kemudian bertanya-tanya, "Ini tidak akan sesuai bagi Saya untuk mengambil derma tersebut dengan tangan Saya. Wadah apakah yang para Tathāgatah Samyaksambuddha masa lalu gunakan untuk menerima derma?" Saat itu jawabannya terbit pada diri-Nya.

Para Bhikshu, mengetahui bahwa itu adalah waktu bagi sang Tathāgata untuk makan, pada saat itu empat mahārājā muncul dari empat penjuru arah membawa empat mangkuk emas (sauvarnāni pātrā). Mereka menawarkannya kepada sang Tathāgata, dengan mengatakan kepada-Nya, "Tolong perhatikan kami dengan kasih sayang dan terimalah empat mangkuk derma yang dari emas ini!"

Dengan berpikir, bagaimanapun, bahwa mangkuk-mangkuk itu tidak sesuai untuk seorang Sramana, sang Tathāgata tidak menerimanya. Jadi, empat mahārājā datang kembali dengan empat mangkuk derma yang terbuat dari 'perak (rūpya)', empat yang terbuat dari vaidūrya, empat yang terbuat dari kuarsa (sphatika), empat yang terbuat dari 'karang (musāragalva)', empat yang terbuat dari 'zamrud (aśmagarbha)', dan empat yang terbuat dari 'semua permata (sarvaratna)'. Mereka menawarkannya kepada sang Tathāgata, namun Dia menolak, berpikir bahwa ini semua tidak pantas bagi seorang Sramana.

Para Bhikshu, sang Tathāgata kemudian berpikir apa jenis mangkuk derma yang para Tathāgata Arhadbhih Samyaksambuddha telah gunakan untuk menerima derma. Dia mengerti bahwa itu adalah mangkuk derma yang terbuat dari batu, dan jadi pikiran itu terbit dalam pikiran sang Tathāgata.

Kemudian Mahārāja Vaisravana berkata kepada tiga Mahārājā lainnya: "Teman-teman, ketika devaputrah dari 'alam biru (nīlakāyika)' memberi kita empat mangkuk derma yang dari batu, kita berpikir bahwa itu untuk kita gunakan. Tapi devaputrah dari nīlakāyika yang bernama Vairocana berkata kepada kita sebagai berikut:

"'Dengar, mangkuk-mangkuk derma ini tidak untuk digunakan.
Jagalah mereka! Mereka akan menjadi yang dihormati sebagai benda suci.
Jina yang bernama Sakyamuni akan muncul;
Berikan mangkuk-mangkuk derma ini kepada-Nya! '

"Teman-teman, waktunya telah tiba sekarang
Untuk mempersembahkan bejana-bejana itu kepada Sakyamuni.
Berikan penghormatan dengan suara merdu dari lagu dan simbal,
Kami akan menawarkan mangkuk pātrā itu.

"Dia adalah bejana yang terbuat dari Dharma dan yang tidak bisa dihancurkan,
Sementara bejana ini, terbuat dari batu, dan bisa rusak.
Dia tidak akan dapat menerima mangkuk yang lain;
Mari kita berangkat sehingga Dia bisa menerimanya! "

Kemudian empat mahārājāh, bersama-sama dengan kerabat dan pengikut mereka, pergi ke tempat sang Tathāgata sambil memegang mangkuk-mangkuk derma itu di tangan mereka dan membawa bunga, dupa, wewangian, karangan bunga, dan salap, bermain simbal dan gong, dan menyanyikan lagu-lagu. Setelah memuja sang Tathāgata, mereka mengisi mangkuk-mangkuk derma itu dengan bunga surga dan mempersembahkannya kepada sang Tathāgata.

Para Bhikshu, sang Tathāgata kemudian berpikir: "Keempat mahārājāh yang setia ini memberi Saya empat mangkuk derma yang terbuat dari batu. Tapi empat terlalu banyak bagi Saya. Namun jika Saya menerima hanya satu, tiga lainnya akan kecewa. Jadi Saya akan mengambil semua empat mangkuk derma itu dan mengubahnya menjadi satu."

Para Bhikshu, sang Tathāgata kemudian mengulurkan tangan kanan-Nya dan berbicara kepada Vaiśravana mahārāja dalam syair-gātha:

"Memberikan kepada sang Sugata mangkuk derma! (upanāmayasva sugatasya bhājanam)
Anda akan menjadi kapal dari Kendaraan Tertinggi. (tvam bhesyase bhājanamagrayāne)
Jika Orang-orang seperti Saya diberikan mangkuk derma, (asmadvidhebhyo hi pradāya bhājanam)
Kesadaran dan kecerdasan Anda tidak akan pernah menghilang. (smrtirmatiścaiva na jātu hīyate)"

Para Bhikshu, sang Tathāgata kemudian menerima mangkuk derma dari Vaiśravana mahārāja, memperhatikan dia dengan kasih sayang. Setelah demikian menerimanya, Dia kemudian berbicara kepada Dhrtarāstra mahārāja dalam syair-gātha:

"Siapa pun yang memberikan mangkuk derma kepada sang Tathāgata
Tidak akan pernah kehilangan 'kesadaran (smrti)' dan 'wawasan (praj˝a)',
Dan akan menghabiskan waktunya dengan 'senang hati bahagia (sukhamsukhena)'
Hingga terbangkitkan pada keadaan yang hening-tenang. "

Para Bhikshu, sang Tathāgata kemudian menerima mangkuk derma dari Dhrtarāstra mahārāja, memperhatikan dia dengan kasih sayang. Setelah menerimanya, Dia berbicara kepada Virūdhaka mahārāja dalam syair-gātha:

"Dengan anda memberikan mangkuk derma yang murni (dadāsi yastvam pariśuddhabhājanam)
Untuk sang Tathāgata yang berpikiran murni (viśuddhacittāya tathāgatāya),
Dan Anda dengan cepat akan menjadi murni dalam pikiran (bhavisyasi tvam laghu śuddhacittah),
Layak dihormati di dunia dewa dan manusia. (praśamsito devamanusyaloke)"

Para Bhikshu, sang Tathāgata kemudian menerima mangkuk derma dari Virūdhaka mahārāja, memperhatikan dia dengan kasih sayang. Setelah menerimanya, Dia berbicara kepada Virūpāksa mahārāja dalam syair-gātha:

"Berikan, dengan maksud dan pengabdian yang tanpa cacat,
Sebuah 'mangkuk yang tanpa cacat (acchidrabhājanam)' untuk sang Tathāgata,
Yang tanpa cacat dalam disiplin sila dan perilaku,
Dan pahala kedermawanan Anda akan tanpa cacat. "

Para Bhikshu, sang Tathāgata kemudian menerima mangkuk derma dari Virūpāksa mahārāja, memperhatikan dia dengan kasih sayang. Ketika Dia telah menerimanya, Dia mengubah keempat mangkuk derma itu menjadi satu melalui 'kekuatan kemauan-Nya (adhimuktibalena)', dan kemudian mengucapkan syair-gātha yang bermakna ini:

"Karena, dalam kehidupan masa lalu, Saya mempersembahkan mangkuk derma,
Mengisinya dengan buah dan membuatnya menjadi indah,
Empat dewa yang berkekuatan ajaib besar sekarang memberi Saya
Empat mangkuk derma yang terbentuk dengan baik ini. "

Pada topik ini, dikatakan:

Resi yang bijaksana ini, dengan wawasan kedalam kenyataan tertinggi,
Menatap 'pohon kebangkitan tertinggi (varabodhivrksam)' selama tujuh malam.
Bumi berguncang dalam enam cara,
Dan kemudian sang Singa ini bangun dengan gerakan dari Singa.

Seperti Raja Gajah, Dia perlahan-lahan berjalan disekitar,
Dan akhirnya mencapai batang pohon ara.
Seperti Gunung Meru, sang Muni duduk di sana tidak tergoyahkan,
Menyerap dalam dhyāna samādhi.

Pada saat itu dua bersaudara Trapusa dan Bhallika,
Dengan gerobak dagang mereka
Dan kereta yang terisi penuh dengan kekayaan,
Mencapai rerimbunan pohon Sala yang penuh mekar.

Seketika, melalui pancaran sinar dari Maha Resi,
Roda-roda tenggelam ke dalam bumi hingga setinggi roda mereka.
Melihat situasi seperti ini,
Pedagang gerobak itu ketakutan.

Membawa pedang, panah, dan tombak,
Mereka menyelidiki siapa yang tinggal berdiam di hutan seperti rusa.
Mereka melihat sang Jinā, yang seperti matahari di langit yang tidak berawan
Dan wajah-Nya yang seperti bulan musim gugur.

Tanpa permusuhan atau kebanggaan,
Mereka menunduk, bertanya-tanya siapakah Dia.
Devata mengatakan dari langit:
"Dia adalah Buddha yang bertindak untuk kesejahteraan dunia.

"Selama tujuh hari dan malam,
Perwujudan dari kasih sayang ini belum memakan makanan atau minuman.
Jika anda ingin meredakan penderitaan diri anda sendiri,
Berikan makanan kepada Tubuh dan Pikiran Yang Terbudidaya ini (bhojethimam bhāvitakāyacittam)! "

Ketika mereka mendengar pidato yang manis ini,
Mereka bersujud kepada sang Jinā dan berputar mengelilingi-Nya.
Merasa senang, mereka memutuskan dengan sahabat mereka
Untuk memberi makan sang Jinā.

Para Bhikshu, pada saat itu kawanan sapi milik pedagang Trapusa dan Bhallika sedang merumput di desa tetangga. Disana sapi-sapi yang diperah susunya dan menghasilkan mentega, yang para gembala itu membawanya ke dua pedagang, Trapusa dan Bhallika, mengatakan: "Tuan-tuan-ku, tolong beri nasehat! Ketika kami memerah semua sapi anda, mereka menghasilkan mentega. Apakah ini menguntungkan atau tidak? "

Beberapa brāhmanā, yang rakus oleh sifat alami, berkata, "Ini adalah menguntungkan, jadi persembahan mewah dari mentega ini harus dilakukan untuk para brāhmanā. "

Para Bhikshu, pada waktu itu, bagaimanapun, seorang brāhmanah yang bernama Śikhandī berbicara. Ia pernah menjadi kerabat dari pedagang Trapusa dan Bhallika dalam kehidupan sebelumnya. Ia telah terlahir kembali di alam Brahma, dan sekarang mewujudkan di antara mereka dalam bentuk seorang brāhmanah. Ia mengatakan syair-gātha berikut kepada pedagang:

"Di masa lalu anda membuat cita-cita:
'Ketika sang Tathāgata mencapai kebangkitan,
Semoga Dia mengambil bagian dari makanan kita
Dan memutar Roda Dharma! '

"Cita-cita ini sekarang telah terpenuhi.
Sang Tathāgata yang mencapai kebangkitan
Harus diberikan makanan ini.
Setelah Dia makan, Dia akan memutar Roda Dharma.

"Bahwa sapi anda menghasilkan mentega yang jernih
Adala pertanda yang sangat menguntungkan, dan terjadi di bawah rasi bintang yang menguntungkan.
Hal ini disebabkan oleh tindakan berjasa
Dari Maha Resi ini. "

Setelah Śikhandī telah menjiwai para pedagang,
Dia kembali ke tempat tinggalnya sendiri.
Trapusa dan lain-lain
Semuanya gembira.

Mereka menggabungkan tanpa kecuali
Semua susu dari seribu sapi,
Mengumpulkan krim dari atas,
Dan dengan hormat menyiapkan makanan.

Mereka membersihkan, mengkilapkan, dan memurnikan
Mangkuk permata yang bernama Bulan (yā ratnapātrī abhu candranāmikā),
Yang berharga seratus ribu koin untuk hanya satu ons,
Kemudian mengisinya sampai penuh dengan makanan.

Membawa madu dan mangkuk permata itu,
Mereka mendekati badan pohon ara dan berkata kepada sang Guru:
"Yang Mulia, tolong terimalah dan menerima kami!
Kami mohon Anda memakan makanan yang disiapkan ini! "

Karena mengasihi dua bersaudara itu,
Dan karena Dia menyadari niat mereka sebelumnya untuk berangkat menuju kebangkitan,
Sang Guru menerima dan memakan makanan itu.
Setelah Dia makan, Dia melemparkan mangkuk itu jauh keatas langit.

Seorang Raja Dewa yang bernama Subrahma
Memperoleh mangkuk permata tertinggi itu,
Dan masih sampai sekarang melakukan pemujaan dengan itu
Dalam dunia Brahma bersama-sama dengan teman-temannya.

Kemudian pada kesempatan itu, sang Tathāgata sangat menggembirakan pedagang Trapusa dan Bhallika dengan syair-gātha ini:

"Semoga keberuntungan surga, yang menyelesaikan tujuan
Dan membawa keberuntungan diseluruh sepuluh penjuru arah,
Memenuhi semua tujuan anda!
Semoga semuanya segera menjadi menguntungkan!

"Seperti karangan bunga di leher Anda,
Semoga ada kemuliaan di tangan kanan anda,
Semoga ada kemuliaan di tangan kiri anda,
Dan semoga ada kemuliaan disekeliling anda!

"Semoga para pedagang itu yang mengejar kekayaan
Dan mengembara di seluruh sepuluh penjuru arah
Mencapai keuntungan yang besar,
Dan semoga itu membawakan mereka kebahagiaan!

"Jika anda, untuk beberapa alasan,
Perlu melakukan perjalanan ke timur,
Semoga rasi bintang di arah itu
Melindungi anda!

"Krttikā dan Rohini,
Mrgaśirā, Ardrā, dan Punarvasu,
Pusya, dan Aślesā -
Ini adalah rasi bintang di timur.

"Semoga tujuh rasi bintang ini (ityete sapta naksatrā),
Para pelindung dunia yang terkenal (lokapālā yaśasvinah),
Para dewa yang berdiam di timur (adhisthitā pūrvabhāge devā),
Sepenuhnya melindungi anda (raksantu sarvatah)!

"Adhipatī dan Raja mereka
Dikenal sebagai Dhrtarāstra.
Semoga Penguasa dari semua gandharva ini,
Bersama dengan matahari, melindungi anda!

"Semoga anak-anaknya yang banyak, bijaksana dan kuat,
Semuanya delapan puluh satu di antaranya bernama Indra,
Secara khusus melindungi Anda
Dengan kesehatan dan kesejahteraan!

"Dalam satu daerah di timur,
Ada delapan dewi (astau devakumārikāh):
Jayanti dan Vijayantī,
Siddhārthā dan Aparājitā,

"Nandottarā dan Nandisenā,
Nandini dan Nandavardhanī.
Semoga mereka secara khusus melindungi anda
Dengan kesehatan dan kesejahteraan!

"Dalam bagian timur ada Cetiya yang bernama Cāpāla,
Dihuni dan dikenal oleh para Jinā, para Arhanta Pelindung.
Semoga Mereka secara khusus melindungi anda
Dengan kesehatan dan kesejahteraan!

"Semoga tempat itu aman untuk anda!
Semoga anda tidak terkena kejahatan!
Semoga anda dilindungi oleh semua dewa,
Dan semoga anda kembali dengan keuntungan yang besar!

"Jika anda, untuk beberapa alasan,
Harus melakukan perjalanan ke selatan,
Semoga rasi bintang di arah itu
Melindungi anda!

"Maghā, Dvau,
Phālguny, Hastā,
Dan Citrā, yang kelima.
Bersama dengan Svāti dan Viśākhā, berada di selatan.

"Ketujuh rasi bintang itu,
Para lokapālā yang terkenal,
Yang tinggal di bagian selatan.
Semoga mereka melindungi anda!

"Adhipatī dan Raja mereka
Disebut Virūdhaka.
Semoga Penguasa semua kumbhānda ini,
Bersama-sama dengan tuan kematian (yama), melindungi anda!

"Semoga anak-anaknya yang banyak, bijaksana dan kuat,
Semuanya sembilan puluh satu di antaranya bernama Indra,
Secara khusus melindungi Anda
Dengan kesehatan dan kesejahteraan!

"Dalam salah satu bagian dari arah selatan,
Ada delapan dewi:
Śriyāmatī dan Yaśamatī,
Yaśaprāptā dan Yasodhara,

"Suutthitā dan Suprathamā,
Suprabuddha dan Sukhāvahā.
Semoga mereka melindungi anda
Dengan kesehatan dan kesejahteraan!

"Dalam bagian selatan ada Cetiya yang bernama Padma,
Terus bersinar dengan kecemerlangan, selalu menerangi semua.
Semoga itu secara khusus melindungi anda
Dengan kesehatan dan kesejahteraan!

"Semoga tempat itu aman untuk anda!
Semoga anda tidak terkena kejahatan!
Semoga anda dilindungi oleh semua dewa,
Dan semoga anda kembali dengan keuntungan yang besar!

"Jika anda, untuk beberapa alasan,
Perlu melakukan perjalanan ke barat,
Semoga rasi bintang yang menghuni arah itu
Melindungi anda!

"Anurādhā dan Jesthā,
Mūlā dan Drdhavīryatā,
Āsādha dan Abhijit,
Dan Śravana - ini adalah tujuh itu.

"Ketujuh rasi bintang,
Para lokapālā yang terkenal,
Yang tinggal di bagian barat.
Semoga mereka selalu melindungi anda!

"Adhipatī dan Raja mereka
Dikenal sebagai Virūpāksa.
Semoga Penguasa semua naga itu,
Bersama dengan Varūna, melindungi anda!

"Semoga anak-anaknya yang banyak, bijaksana dan kuat,
Semuanya sembilan puluh satu di antaranya bernama Indra,
Secara khusus melindungi Anda
Dengan kesehatan dan kesejahteraan!

"Di bagian barat,
Ada delapan dewi:
Alambuśā dan Miśrakeśī,
Pundarīkā dan Arunā,

"Ekādaśā, Navanāmikā,
Sītā dan Krsnā Draupadī.
Semoga mereka secara khusus melindungi anda
Dengan kesehatan dan kesejahteraan!

"Dalam bagian barat, ada gunung yang bernama Astamga;
Matahari dan bulan juga berada di sana.
Semoga gunung itu memberikan anda kekayaan
Dan melindungi anda dengan kesehatan dan kesejahteraan!

"Semoga tempat itu aman untuk anda!
Semoga anda tidak terkena kejahatan!
Semoga anda dilindungi oleh semua dewa,
Dan semoga anda kembali dengan kekayaan!

"Jika karena alasan tertentu
Anda harus melakukan perjalanan ke utara,
Semoga rasi bintang di arah itu
Melindungi anda!

"Ada tujuh:
Dhanisthā, Śatabhisā,
Pasangan Purva Apara dan Uttara Apara,
Ravati dan Aśvinī dan Bharani.

"Ketujuh rasi bintang itu,
Para lokapālā yang terkenal,
Yang tinggal di bagian utara.
Semoga mereka selalu melindungi anda!

"Adhipatī dan Raja mereka
Apakah Kubera, diangkat oleh laki-laki.
Semoga Penguasa semua Yaksa ini,
Bersama dengan Manibhadra, melindungi anda!

"Semoga anak-anaknya yang banyak, bijaksana dan kuat,
Semuanya sembilan puluh satu di antaranya bernama Indra,
Secara khusus melindungi anda
Dengan kesehatan dan kesejahteraan!

"Dalam bagian utara,
Ada delapan dewi:
ilādevī dan Surādevī,
Prthvī dan Padmāvatī,

"Maharaja, Aśā,
Sraddhā, dan Sirī yang sederhana.
Semoga mereka secara khusus melindungi anda
Dengan kesehatan dan kesejahteraan!

"Dalam bagian utara ada gunung Gandhamādana.
Itu adalah tempat tinggal semua Yaksa dan Bhūtā,
Memiliki banyak puncak, dan menyenangkan untuk dilihat.
Semoga itu juga melindungi anda dengan kesehatan dan kesejahteraan!

"Semoga tempat itu aman untuk anda!
Semoga anda tidak terkena kejahatan!
Semoga semua dewa melindungi anda,
Dan semoga anda kembali dengan kekayaan!

"Dua puluh delapan 'rasi bintang (naksatrā)' itu,
Tujuh tinggal di masing-masing empat penjuru arah,
Tiga puluh dua 'dewi (devakanyā)',
Delapan tinggal di masing-masing empat penjuru arah,

"Delapan śramanā, delapan brāhmanā,
Delapan kota di seluruh negeri,
Dan delapan dewa, bersama-sama dengan Sakra Indra nya,
Semoga mereka semua melindungi anda!

"Semoga anda memiliki nasib baik saat pergi!
Semoga anda memiliki nasib baik saat kembali!
Semoga anda memiliki nasib baik melihat kerabat anda!
Semoga anda memiliki nasib baik dilihat oleh kerabat anda!

"Penuh cinta dirawat oleh banyak Yaksā dengan Śakra Indra mahārājā mereka
Dan oleh para Arhanta,
Semoga anda bepergian dengan senang hati di mana-mana
Dan memperoleh nektar yang menguntungkan.

"Selalu penuh cinta dilindungi oleh Brāhma dan Vāsava,
Dan oleh mereka yang bebas dari arus keluar yang pikirannya terbebaskan,
Dan juga oleh Nāga dan Yaksa,
Semoga kehidupan anda dipertahankan selama seratus musim gugur! "

Sang Pemandu tiada bandingan, sang Lokanāthah,
Kemudian memuji persembahan mereka sebagai kebetulan, dengan mengatakan,
"Melalui 'perbuatan kebajikan (kuśalena karmanā)' ini,
Anda akan menjadi Jinā yang bernama Madhusambhavā! "

Ini adalah Vyākarana yang pertama dibuat
Oleh sang Jinā, sang Lokavināyaka.
Yang tidak terhingga banyaknya para Bodhisattva yang diramalkan kemudian
Tidak mungkin berpaling dari Kebangkitan.

Ketika mereka mendengar ramalan sang Jinā,
Dua bersaudara itu bergembira dan sangat senang.
Bersama dengan para sahabat mereka,
Mereka pergi untuk berlindung pada Buddha dan Dharma.

Demikianlah Sri Lalitavistara Bagian kedua puluh empat tentang Trapusa dan Bhallika.
(iti śrīlalitavistare trapusabhallikaparivarto nāma caturvimśatitamo'dhyāyah)


Terakhir diubah oleh skipper tanggal Fri Feb 12, 2016 9:52 pm, total 8 kali diubah

skipper

Jumlah posting : 439
Join date : 27.11.08
Age : 28

Lihat profil user http://aryamahayana.forumup.com

Kembali Ke Atas Go down

OM AH HUM

Post by skipper on Sun Jan 24, 2016 4:37 pm




adhyesanāparivartah pa˝cavimśah
Bab 25 - Khotbah

Para Bhikshu, ketika sang Tathāgata duduk di 'badan Pohon Ara (tārāyanamūle)', dalam kesendirian yang sunyi setelah Dia pertama mencapai ābhisambuddha, Dia memiliki pemikiran berikut tentang orang-orang yang bertindak 'sesuai dengan duniawi (lokānuvartanām)':

"Kebenaran yang Saya sadari dan terbangunkan adalah yang mendalam (gambhīro), penuh kedamaian (śāntah), hening (praśānta), tenang (upaśāntah), lengkap (pranīto), sulit dilihat (durdrśo), sulit dipahami dan tidak mungkin untuk diartikan karena itu tidak dapat diakses pada kecerdasan (duranubodho'tarko'vitarkāvacarah). Hanya para Arya yang bijaksana dan para mahir yang dapat memahaminya. Ini adalah pemahaman yang lengkap dan pasti dari meninggalkan semua kumpulan, akhir dari semua perasaan, kebenaran mutlak, dan kebebasan dari fondasi. Ini adalah keadaan yang penuh ketenangan, bebas dari kemelekatan, bebas dari menggenggam, tidak teramati, tidak bisa ditunjukkan, tidak bisa digabung, melampaui di luar enam bidang indera, tidak bisa dipahami, tidak terbayangkan, dan tidak terkatakan. Ini adalah tidak terlukiskan, tidak terungkapkan, dan tidak mampu untuk digambarkan. Ini tidak terhalangi, melampaui di luar semua petunjuk, keadaan dari penghentian melalui jalur keheningan yang tenang, dan tidak bisa terlihat, sama seperti kekosongan. Ini adalah penghabisan hasrat keinginan dan ini adalah penghentian yang bebas dari nafsu keinginan. Ini adalah Nirvana. Jika Saya harus mengajarkan Kebenaran ini kepada orang lain, mereka tidak akan mengerti. Mengajarkan Kebenaran ini akan menjemukan Saya dan akan dengan salah ditentang, dan ini akan menjadi sia-sia. Jadi Saya akan tetap diam dan menyimpan Kebenaran ini dalam hati Saya. "

Pada saat itu Dia mengucapkan syair-gātha ini:

"Mendalam, penuh kedamaian, tanpa noda, jernih, dan tidak berkondisi -
Demikian itu adalah Kebenaran yang sama seperti nektar yang telah Saya sadari.
Jika Saya mengajarkannya, tidak ada yang akan mengerti,
Jadi Saya akan tetap diam tinggal di hutan.

"Saya telah menemukan kemutlakan yang paling luhur dan menakjubkan,
Keadaan yang tidak terlukiskan, tidak ternoda oleh bahasa,
Apa adanya (tathā), sifat alami yang sama seperti langit dari gejala kejadian,
Sepenuhnya bebas dari yang berubah-rubah, pergerakan gagasan.

"Makna ini tidak bisa dipahami melalui kata-kata;
Melainkan dipahami melalui mencapai batas nya.
Namun ketika para makhluk hidup, yang para Jina masa lalu membimbing mereka,
Mendengar tentang Kebenaran ini, mereka mengembangkan kepercayaan diri di dalamnya.

"Tidak ada Dharma sama sekali yang ada di sini;
Itu yang tidak memiliki keberadaan tidak bisa ditemukan.
Bagi orang yang mengetahui rantai dari sebab-akibat dan tindakan,
Tiada keberadaan maupun tiada ketidakberadaan di sini.

"Selama yang tidak terhitung ratusan ribu kalpa,
Saya meniru para Jina masa lalu,
Tapi Saya tidak mencapai kesabaran pada kenyataannya
Bahwa tidak ada diri, tidak ada makhluk hidup, dan tidak ada kekuatan hidup.

"Ketika Saya mencapai 'kesabaran (ksāntī )' ini
Bahwa tiada yang meninggal atau lahir di sini,
Bahwa sifat alami dari semua gejala kejadian ini adalah menjadi yang tanpa diri,
Kemudian Buddha Dipamkara membuat ramalan tentang Saya.

"Dengan kasih sayang Saya yang tidak terbatas untuk seluruh dunia,
Saya tidak akan berdiri untuk sembarang orang yang memohon.
Para makhluk ini semuanya berkeyakinan kepada Brahma;
Dengan demikian, ketika ia yang memohon, Saya akan memutar Roda Dharma.

"Itu hanya akan cocok untuk mendatangkan Dharma Saya ini
Jika Brahma yang jatuh ke kaki Saya,
Memohon Saya untuk menjelaskan Dharma yang tanpa noda dan luhur,
Dan jika ada makhluk cerdas dari sifat yang baik. "

Para Bhikshu, pada waktu itu sang Tathāgata memancarkan cahaya dari pusat dahi (ūrnā)-Nya, yang menerangi seluruh trisāhasramahāsāhasra lokadhātu dengan kecemerlangan yang berwarna emas (suvarnavarnā). Kemudian, dengan kekuatan Buddha (buddhānubhāvenaiva), Mahā Brahmā Sikhī, sang Adhipati dari daśatrisāhasramahāsāhasrā, menjadi sadar akan maksud sang Tathāgata. Setelah mengerti bahwa sang Bhagavata mempertimbangkan menyimpan Dharma untuk diri-Nya Sendiri tanpa mengajarkannya, ia berpikir, "Saya pasti akan mendekati dan meminta sang Tathāgata untuk memutar Roda Dharma!"

Jadi saat itu Mahā Brahmā Sikhī menyapa para devaputrā lainnya dari alam Brahma: "Teman-teman! Meskipun sang Tathāgata telah mencapai Anuttarā samyaksambodhimabhisambudhy, Dia mempertimbangkan menyimpan Dharma untuk diri-Nya Sendiri tanpa mengajarkannya. Sayang! Dunia ini binasa! Sayang, teman-teman, dunia ini benar-benar binasa! Jadi kita tentu harus pergi dan meminta sang Tathāgatamarhantam samyaksambuddha, untuk memutar Roda Dharma."

Para Bhikshu, kemudian Mahā Brahmā Sikhī, dikelilingi dan dikawal oleh 6,8 juta Brahmā, pergi ke sang Tathāgata. Ketika ia tiba, ia menundukkan kepalanya ke kaki sang Tathāgata, dan dengan telapak tangan beranjali, mengatakan ini kepada-Nya: "Bhagavan, bahkan setelah mencapai Anuttarā samyaksambodhimabhisambudhy, Anda bertekad menjaga Dharma untuk Diri Sendiri tanpa mengajarkannya. Sayang, Bhagavān! Dunia ini binasa! Sayang, Sugato, dunia ini benar-benar binasa! Ada makhluk hidup yang cerdas dari sifat yang baik dengan potensi, keberuntungan, dan kemampuan untuk memahami makna dari apa yang Bhagavan katakan. Yang demikian itu adalah perkara itu, Bhagavan, tolong dengan fasih ajarkanlah Dharma! Tolong, Sugata, ajarkanlah Dharma! "

Kemudian Brahma berbicara syair-gātha ini:

"Setelah menyelesaikan Mandala kebijaksanaan besar tertinggi,
Memancar sinar cahaya diseluruh sepuluh penjuru arah,
Sinar kebijaksanaan Anda bisa membawa orang yang seperti bunga teratai untuk mekar.
Jadi mengapa hari ini, Sinar Pidato (vādibhāskarah), Anda tetap tidak memperhatikan?

"Meyakinkan para makhluk hidup dengan kekayaan para Arya,
Anda bisa menenangkan puluhan juta makhluk.
Itu adalah tidak cocok, Teman Dunia,
Anda diam tetap tidak memperhatikan dunia!

"Semoga Anda memukul 'genderang Dharma yang luhur (uttamadharmadundubhim)'!
Semoga Anda meniup 'keong Dharma yang asli (saddharmaśankham)'!
Semoga Anda menegakkan 'tiang Dharma yang besar (mahadharmayūpam)!
Semoga Anda menyalakan 'lampu Dharma yang besar (mahadharmadīpam)'!

"Semoga Anda menurunkan hujan Dharma, yang paling luhur!
Semoga Anda menyeberangkan semua yang berkubang di 'lautan keberadaan (bhavasāgara)'!
Semoga Anda membebaskan semua yang menderita penyakit parah!
Semoga Anda memadamkan api penderitaan yang menyiksa mereka!

"Semoga Anda mengajarkan 'jalan menuju kedamaian (śāntimārgam)' -
Yang menggembirakan, menguntungkan, abadi, dan tanpa kesedihan.
Berbelas kasihlah, Nātha, kepada mereka yang berada di jalan yang salah;
Mereka tidak tertolong, karena mereka tidak menempuh jalan ke Nirvana!

"Semoga Anda membuka 'pintu gerbang pembebasan (vimoksadvārāni)'!
Semoga Anda menjelaskan jalan yang tidak asing dari Dharma!
Semoga Anda, Nātha, memurnikan mata yang luhur dari Dharma
Untuk makhluk yang buta sejak lahir!

"Tidak dalam dunia Brahma, tidak juga dalam dunia dewa, (na brahmaloke na ca devaloke)
Tidak juga dalam dunia Yaksa, gandharva, atau manusia (na yaksagandharvamanusyaloke)
Yang akan menghapus kelahiran dan kematian di dunia ! (lokasya yo jātijarāpanetā)
Tidak ada satu pun tapi hanya Anda, Pelindung, sang Bulan diantara manusia. (nānyo'sti tvatto hi manusyacandrah)

"Terimalah semua dewa,
Dharmarāja, saya memohon Anda!
Melalui jasa kebajikan ini, semoga saya juga cepat
Memutar Roda Dharma, yang paling luhur! (pravartayeyam varadharmacakram)"

Para Bhikshu, agar untuk menunjukkan kebaikan kepada dunia dari para dewa, manusia, dan asura, sang Tathāgata memandang dunia ini dengan kasih sayang dan dengan diam memberikan persetujuan kepada Brahma Sikhin. Tentu saja, setelah Mahā Brahmā Sikhi memahami bahwa sang Tathāgata telah dengan diam memberikan persetujuan, ia menaburi sang Tathāgata dengan bubuk cendana surga dan bubuk kayu gaharu surga, menjadi bergembira dan sangat senang, dan kemudian menghilang pada saat itu juga.

Para Bhikshu, dalam rangka untuk menimbulkan penghormatan kepada Dharma di dunia, dalam rangka untuk meningkatkan akar kebajikan dengan membuat Mahā Brahmā Sikhi berulang kali meminta Dharma, dan karena Dharma adalah sangat mendalam, sang Tathāgata kembali lagi menuju ke dalam kesendirian yang sunyi dan memiliki pemikiran sebagai berikut:

"Kebenaran yang Saya bangunkan ini adalah yang mendalam, halus, bercahaya, sulit dipahami, tidak terbayangkan, dan melampaui di luar kecerdasan. Dipahami hanya oleh yang pandai dan yang bijaksana, ini adalah diluar dari langkah dengan semua orang duniawi dan sulit untuk dilihat. Ini adalah meninggalkan semua kumpulan, berhentinya semua pembentukan, keadaan dari penghentian melalui jalur keheningan tenang, dan tidak bisa terlihat sama seperti kekosongan. Ini adalah penghabisan hasrat keinginan, dan ini adalah penghentian yang terbebas dari nafsu keinginan. Ini adalah Nirvana. Jika Saya harus mengajarkan Kebenaran ini, dan jika orang lain tidak memahaminya, ini akan menjemukan Saya. Jadi Saya pasti akan terus menyimpannya untuk Diri Sendiri. "

Para Bhikshu, dengan kekuatan Buddha, Mahā Brahmā Sikhi kembali lagi menyadari pikiran ini dari sang Tathāgata, dan ia pergi untuk bertemu Sakra Dewa Indra. Ketika ia tiba, ia mengatakan kepada Sakra Dewa Indra:

"Pahamilah, Kausika, sang Tathāgata Arhatah Samyaksambuddha bertekad tidak mengajarkan Dharma dan dengan demikian menyimpannya pada Diri-Nya Sendiri! Dan karena sang Tathāgata Arhatah Samyaksambuddha, bertekad tidak mengajarkan Dharma dan dengan demikian menyimpannya pada Diri-Nya Sendiri, sayang, Kausika, dunia pasti binasa! Sayang, Kausika, dunia ini benar-benar binasa! Sayang, dunia ini akan terjun ke dalam kegelapan besar dari kebodohan! Mengapa kita tidak kemudian pergi dan meminta sang Tathāgata Arhatah Samyaksambuddha, memutar Roda Dharma? Karena para Tathāgatā tidak memutar Roda Dharma tanpa diminta! "

"Baiklah, temanku!" Jawab Sakra.

Dan jadi ketika malam telah berlalu, Sakra, Brahma, dewa bumi, dewa antarīksā, dan dewa dari surga Cāturmahārājakāyikā, surga Trāyatrimśā, surga Yāmā, surga Tusitā, surga Nirmānarati, surga Paranirmitavaśavarti, surga Brahmakāyikā, surga Abhāsvarā, surga Brhatphalā, surga Subhakrtsnā, dan Suddhāvāsakāyika - banyak ratusan ribu dewa yang berpenampilan indah - menerangi daerah di sekitar Pohon Ara itu dengan keindahan surga mereka dan kilauan surga mereka, dan mendekati sang Tathāgata. Mereka menundukkan kepala mereka ke kaki sang Tathāgata, berpradaksina pada-Nya, dan berdiri di satu sisi. Kemudian Sakra devānāmindra, bersujud dengan telapak tangan yang beranjali kearah sang Tathāgata dan memuji-Nya dalam syair-gātha:

"Pikiran Anda benar-benar terbebaskan,
Seperti bulan purnama yang bebas dari gerhana.
Semoga Anda bangun, Pemenang Pertempuran!
Semoga Anda memancarkan cahaya wawasan bijak dalam dunia yang gelap ini! "

Ketika ia mengatakan itu, sang Tathāgata tetap diam. Kemudian Mahā Brahmā Sikhi berbicara kepada Sakra devānāmindra: "O Kausika, para Tathāgatā arhantah samyaksambuddhā tidak dimohon untuk memutar Roda Dharma dengan cara yang anda mohon itu. "

Jadi Mahā Brahmā Sikhi menggantungkan jubahnya di satu bahu, berlutut di lutut kanannya, dan membungkukkan diri kearah sang Tathāgata dengan telapak tangan beranjali, berbicara syair-gātha ini kepada-Nya:

"Semoga Anda bangun, Pemenang Pertempuran!
Semoga Anda memancarkan cahaya wawasan bijak dalam dunia yang gelap ini!
Para makhluk akan menjadi berpengetahuan luas.
Muni, semoga Anda mengajarkan Dharma! "

Para Bhikshu, ketika ia mengatakan itu, sang Tathāgata mengulangi kepada Mahā Brahmā Sikhi: "Mahā Brahmā, Kebenaran yang Saya bangunkan ini adalah yang mendalam, halus, bercahaya, sulit dipahami, tidak terbayangkan, dan melampaui di luar kecerdasan. Dipahami hanya oleh yang pandai dan yang bijaksana, ini adalah diluar dari langkah dengan semua orang duniawi dan sulit untuk dilihat. Ini adalah meninggalkan semua kumpulan, berhentinya semua pembentukan, keadaan dari penghentian melalui jalur keheningan tenang, dan tidak bisa terlihat sama seperti kekosongan. Ini adalah penghabisan hasrat keinginan, dan ini adalah penghentian yang terbebas dari nafsu keinginan. Ini adalah Nirvana. Jika Saya harus mengajarkan Kebenaran ini, dan jika orang lain tidak memahaminya, ini akan menjemukan Saya. Dan syair-gātha ini, Brahma, adalah jawaban Saya kepada anda, berkali-kali:

"Jalan Saya, yang melawan arus, adalah mendalam.
Sulit untuk dilihat,
Karena mereka yang dibutakan oleh nafsu keinginan tidak melihatnya.
Oleh karena itu mengajarkannya tidak akan membantu apapun.

"Para makhluk, terikat dengan nafsu keinginan mereka,
Terus-menerus hanyut di sungai.
Saya menemukan ini dengan usaha besar;
Oleh karena itu mengajarkannya tidak akan membantu apapun! "

Para Bhikshu, ketika Mahā Brahmā Sikhi dan Sakra devānāmindra, memahami bahwa sang Tathāgata akan tetap diam, dua makhluk besar ini dan rombongan devaputra mereka, sedih dan murung, menghilang saat itu juga. Dan jadi sang Tathāgata telah tiga kali memutuskan untuk tetap tidak tertarik.

Para Bhikshu, pada waktu itu segala macam hal yang buruk, pendapat yang bertanda buruk mulai beredar di antara orang-orang di Magadha. Beberapa mengatakan bahwa angin tidak akan bertiup lagi, dan beberapa mengatakan bahwa api tidak akan membakar lagi. Beberapa mengatakan bahwa hujan tidak akan turun lagi, beberapa mengatakan bahwa sungai tidak akan mengalir lagi, dan beberapa mengatakan bahwa tanaman tidak akan tumbuh lagi. Beberapa mengatakan bahwa burung tidak akan terbang di langit lagi, dan beberapa mengatakan bahwa wanita hamil tidak akan melahirkan dengan aman lagi.

Para Bhikshu, Mahā Brahmā Sikhi mengetahui sifat alami dari pikiran sang Tathāgata, dan ia menyadari pendapat di antara orang-orang di Magadha. Jadi, saat mendekati malam, ia menerangi seluruh daerah di sekitar pohon ara dengan cahaya surga yang indah warnanya, dan ia mendekati sang Tathāgata. Ketika ia tiba, ia menundukkan kepala ke kaki sang Tathāgata, menggantungkan jubahnya di satu bahu, berlutut di lutut kanannya, dan membungkukkan diri ke depan dengan telapak tangan beranjali, berbicara dalam syair-gātha kepada sang Tathāgata:

"Sebelumnya di Magadha, Dharma tidak murni,
Oleh karena itu pembicaraan yang di tafsirkan secara tidak murni telah muncul di sana.
Jadi, tolong, Muni, bukalah pintu gerbang nektar!
Mereka siap untuk mendengarkan Buddhadharma yang tanpa noda!

"Dengan tujuan Anda tercapai, Anda mencapai kebebasan.
Setelah menghapus noda dari pembentukan penderitaan,
Kebajikan Anda adalah tanpa kenaikan atau penurunan.
Di sini, dalam Dharma yang terbaik, Anda telah mencapai kesempurnaan pārami!

"Muni, tidak ada yang seperti Anda di sini di dunia ini!
Maha Resi, bagaimana mungkin Anda bisa dilampaui?
Menjadi yang terbaik, Anda bersinar di sini di tiga dunia,
Sama seperti gunung di alam para asura!

"Tolong kasihanilah para makhluk yang menderita!
Ini tidaklah pernah cocok untuk Orang yang seperti Anda untuk tetap tidak peduli!
Anda diberkahi dengan keberanian dan kekuatan!
Hanya Anda yang bisa menyelamatkan para makhluk!

"Semoga semua makhluk yang menahan sakit begitu lama,
Termasuk para dewa, śramanā, dan dvijākhilā,
Menjadi sehat dan bebas dari penyakit!
Mereka tidak memiliki perlindungan yang lain di sini!

"Dewa dan manusia telah mengikuti Anda begitu lama,
Merindukan nektar dengan pikiran bajik,
'Semoga Dharma diberitakan, Dharma yang tidak kurang dari
Persis apa yang Jina mengerti! '

"Oleh karena itu kami memohon Anda, dengan kekuatan Anda yang sangat bersemangat dan baik hati,
Semoga Anda melatih para makhluk hidup yang telah lama menyimpang dari sang Jalan!
Mereka telah merindukan untuk mendengar makna dari yang belum terdengar,
Sama seperti yang lemah merindukan diberi makanan.

"Orang-orang yang menderita haus, Mahā Muni,
Sedang menunggu kehadiran Anda untuk 'Air Dharma (dharmajalam)' ini.
Sama seperti awan di atas tanah bumi yang kering,
Nāyaka, puaskanlah mereka dengan 'Hujan Dharma (dharmavrstyā)'!

"Lama tersesat, orang-orang berkeliaran di seluruh keberadaan
Tebal dengan pandangan salah dan penuh dengan duri.
Beritahukanlah Jalan yang lurus itu, yang terbebas dari semak berduri,
Dimana Nektar dicapai ketika bermeditasi padanya!

"Yang buta, yang tanpa Pemandu telah jatuh kedalam jurang,
Tidak bisa dipimpin keluar oleh orang lain di sini.
Anda, sang Banteng yang pandai, timbulkanlah semangat
Dan selamatkanlah mereka yang telah jatuh ke dalam jurang yang curam!

"Pertemuan dengan Anda, Muni, selalu begitu lama datang.
Para Jinā Nāyakāh muncul di bumi ini adalah sangat jarang,
Sama seperti bunga Udumbara.
Pelindung, tolong bebaskanlah para makhluk hidup yang telah mencapai kesempatan ini!

"Dalam keberadaan masa lampau Anda memiliki pikiran:
'Setelah Saya sendiri telah menyeberang, Saya akan mengangkut orang lain menyeberang!'
Sekarang bahwa Anda memang telah mencapai pantai lainnya,
Tepati sumpah kesungguhan Anda, dengan kekuatan semangat dari kebenaran!

"Muni, lenyapkanlah kegelapan dengan lampu dari Dharma!
Angkat tinggi panji para Tathāgata!
Waktunya telah tiba untuk mengucapkan Pidato Yang Merdu!
Saya mohon Anda untuk mengumandangkan seperti singa, Yang Bersuara Seperti Genderang (dundubhisvarah)! "

Para Bhikshu, maka sang Tathāgata melihat seluruh dunia dengan 'Mata Terbangkitkan-Nya (buddhacaksusā)' dan melihat para makhluk hidup yang mendasar, biasa-biasa saja, dan yang maju; Mereka yang tinggi, rendah, dan menengah; Mereka yang dari sifat yang baik dan mudah untuk dimurnikan, mereka yang dari sifat yang buruk dan sulit untuk dimurnikan; Mereka yang dapat mengerti melalui hanya sebuah pernyataan singkat, dan mereka yang kata-kata adalah hal yang terpenting dan yang mengandalkan penjelasan rinci untuk pemahaman mereka. Dia dengan demikian melihat bahwa makhluk hidup dikelompokkan menjadi tiga kategori: orang yang pasti salah, orang yang pasti benar, dan orang yang belum ditentukan. Para Bhikshu, sama seperti ketika Orang yang berdiri di tepi kolam bunga teratai melihat beberapa bunga teratai terendam di dalam air, beberapa bunga teratai di tingkat ketinggian air, dan beberapa bunga teratai di atas air, ini adalah bagaimana sang Tathāgata melihat para makhluk hidup yang terletak di dalam tiga kelompok ketika Dia melihat di seluruh dunia dengan buddhacaksu-Nya.

Para Bhikshu, maka sang Tathāgata berpikir, "Apakah Saya mengajarkan Dharma atau tidak, kelompok ini yang pasti salah tidak akan memahami Dharma. Dan apakah Saya mengajarkan Dharma atau tidak, kelompok ini yang pasti benar akan memahami Dharma. Namun kelompok yang belum ditentukan akan memahami Dharma jika Saya mengajarkannya, tapi tidak akan memahami Dharma jika Saya tidak mengajarkannya. "

Para Bhikshu, kemudian sang Tathāgata menimbulkan kasih sayang yang besar, dimulai dengan makhluk hidup yang terletak pada kelompok yang belum ditentukan. Para Bhikshu, dari pandangan kebijaksanaan sempurna-Nya sendiri, sang Tathāgata kemudian memahami permintaan yang dibuat oleh Mahā Brahmā Sikhi dan dengan demikian berbicara kepadanya dengan syair-gātha ini:

"Brahma, gerbang dari nektar terbuka
Untuk para makhluk hidup dari Magadha itu
Yang dengan telinga dan dengan pengabdian,
Yang terus-menerus mendengarkan dengan perhatian dan tanpa merugikan. "

Kemudian, setelah Mahā Brahmā Sikhi paham bahwa sang Tathāgata telah setuju, ia bersukacita dengan kepuasan dan keriangan. Sangat senang dan gembira, ia membungkuk dengan kepalanya ke kaki sang Tathāgata dan menghilang di sana.

Para Bhikshu, pada kesempatan itu para dewa bumi kemudian mengumumkan dan memberitahukan kepada para dewa antarīksa:

"Hari ini teman-teman, sang Tathāgata Arhatā Samyaksambuddha telah berkeinginan untuk memutar Roda Dharma. Dia akan melakukan ini untuk menguntungkan banyak makhluk, untuk membawa kebahagiaan kepada banyak makhluk, untuk dengan penuh kasih sayang merawat dunia, untuk kesejahteraan, kemajuan, dan kebahagiaan dari para dewa, manusia, dan sebagian besar makhluk. Dengar, teman-teman! Alam asurāh akan berkurang. Alam surga (divyāh kāyāh) akan diisi. Dan banyak makhluk hidup di dunia akan mencapai Parinirvāna!"

Setelah para āntarīksā devā mendengar ini dari para bhaumā devāta, mereka mengumumkan kepada para cāturmahārājikā devā. Para cāturmahārājikā devā mengatakan kepada yang di surga trāyatrimśā. Yang di surga trāyatrimśā mengatakan kepada yang di surga yāmā. Yang di surga yāmā mengatakan kepada yang di surga tusita dan surga nirmānaratī. Yang di surga tusita dan surga nirmānaratī mengatakan kepada yang di surga paranirmitavaśavarti. Akhirnya mereka mengumumkan dan memberitahukan ini untuk para dewa dari brahmakāyikā:

"Hari ini teman-teman, sang Tathāgata Arhatā Samyaksambuddha telah berkeinginan untuk memutar Roda Dharma. Dia akan melakukan ini untuk menguntungkan banyak makhluk, untuk membawa kebahagiaan kepada banyak makhluk, untuk dengan penuh kasih sayang merawat dunia, untuk kesejahteraan, kemajuan, dan kebahagiaan dari para dewa, manusia, dan sebagian besar makhluk. Dengar, teman-teman! Alam asurāh akan berkurang. Alam surga akan diisi. Dan banyak makhluk hidup di dunia akan mencapai Parinirvāna!"

Para Bhikshu, kemudian secara bersamaan semua dari mereka, dimulai dengan dewa bumi hingga sampai ke para dewa dari alam Brahma, mengumumkan secara serempak pengumuman yang sama seperti sebelumnya: "Hari ini teman-teman, sang Tathāgata Arhatā Samyaksambuddha telah berkeinginan untuk memutar Roda Dharma. Dia akan melakukan ini untuk menguntungkan banyak makhluk, untuk membawa kebahagiaan kepada banyak makhluk, untuk dengan penuh kasih sayang merawat dunia, untuk kesejahteraan, kemajuan, dan kebahagiaan dari para dewa, manusia, dan sebagian besar makhluk. Dengar, teman-teman! Alam asurāh akan berkurang. Alam surga akan diisi. Dan banyak makhluk hidup di dunia akan mencapai Parinirvāna!"

Para Bhikshu, maka para dewata dari pohon Bodhi (bodhivrksadevatā) yang bernama Dharmaruci, Dharmakaya, Dharmamati, dan Dharmacāri jatuh ke kaki sang Tathāgata dan bertanya: "Dimanakah, Bhagavān, Roda Dharma akan diputar? (kva bhagavān dharmacakram pravartisyatīti?)"

Para Bhikshu, ketika mereka mengatakan itu, sang Tathāgata menjawab: "Di 'Taman Rusa (mrgadāva)' dekat Bukit Gugurnya Orang Bijak (resipatana), Varanasi."

Lalu mereka berkata, "Bhagavan, di Vārānasī Mahā Nagarī hanya memiliki penduduk yang terbatas, dan di Taman Rusa hanya memiliki jumlah terbatas dari naungan pohon. Ada kota besar lainnya, Bhagavan, yang kaya, subur, aman, dan menyenangkan, dengan kelimpahan persediaan, penuh dengan banyak orang dan makhluk, dan terhiasi dengan taman-taman, hutan, dan gunung-gunung. Semoga Bhagavan, tolong putarlah Dharma Cakra di salah satu tempat-tempat yang lainnya! "

Sang Tathāgata menjawab:

"Jangan mengatakan hal seperti itu, tuan-tuan yang baik! Dan mengapa?

"Saya melakukan enam puluh triliun pengorbanan disana;
Saya membuat persembahan kepada enam puluh triliun Buddhā di sana.
Varanasi adalah tempat yang disukai dari para Resi masa lampau;
Tempat ini, dimuliakan oleh para devā dan nāga, yang pernah membangkitkan Dharma.

"Saya ingat bahwa sembilan puluh satu miliar Buddhā masa lampau
Memutar Roda Agung di dalam hutan tertinggi itu yang dinamai menurut para Resi,
Di mana kedamaian, keheningan tenang, dan pemusatan pikiran tercapai, dan rusa selalu tinggal berdiam.
Jadi Saya juga akan memutar Roda Agung di dalam hutan tertinggi itu yang dinamai menurut para Resi. "

Demikianlah Sri Lalitavistara Bagian kedua puluh lima tentang Khotbah.
(|iti śrīlalitavistare'dhyesanāparivarto nāma pa˝cavimśatitamo'dhyāyah)


Terakhir diubah oleh skipper tanggal Wed Feb 10, 2016 8:45 pm, total 6 kali diubah

skipper

Jumlah posting : 439
Join date : 27.11.08
Age : 28

Lihat profil user http://aryamahayana.forumup.com

Kembali Ke Atas Go down

OM TARA SIDDHAM

Post by skipper on Sat Jan 30, 2016 10:03 pm




dharmacakrapravartanaparivartah sadvimśah
Bab 26 - Memutar Roda Dharma

Para Bhikshu, pada saat itu sang Tathāgata telah menyelesaikan segala sesuatu yang harus Dia lakukan. Dengan tidak ada lagi yang untuk dicapai, semua belenggu nya telah termusnahkan (sarvabandhanasamucchinnah). Semua 'emosi buruk (kleśo)' telah dibersihkan, bersama dengan noda batinnya. Dia telah menaklukkan Mara dan semua kekuatan musuh (nihatamārapratyarthikah), dan sekarang Dia ikut serta dengan Jalan Dharma dari semua Buddha (sarvabuddhadharmanayānupravistah). Dia telah menjadi 'Maha Tahu Semua (sarvaj˝ah)' dan Melihat Semua (sarvadarśī). Memiliki sepuluh kekuatan dan telah menemukan keberanian empat kali lipat (daśabalasamanvāgataścaturvaiśāradyaprāpto). Delapan belas kualitas yang unik dari seorang Buddha telah terbentang dalam diri-Nya (astādaśāvenikabuddhadharmapratipūrnah). Dilengkapi dengan penglihatan lima kali lipat (pa˝cacaksuhsamanvāgato), Dia mengamati seluruh dunia dengan Mata Buddha yang tidak terhalangi dan mulai merenungkan:

"Kepada siapa Saya harus mengajarkan Dharma ini untuk pertama kalinya? Siapa yang murni, baik hati, mudah untuk dilatih, dan guru yang baik yang mampu memurnikan orang lain? Siapa yang memiliki sedikit keinginan, kemarahan, dan angan-angan khayalan? Siapa yang berpikiran terbuka dan menderita karena tidak pernah mendengar Dharma? Orang yang seperti itu Saya harus mengajar pertama-tama. Orang yang mengerti ajaran Saya tidak akan berbalik melawan Saya. "

Kemudian, para Bhikshu, sang Tathāgata berpikir pada Diri-Nya Sendiri:

"Rudraka, putra dari Rāma, murni dan baik hati. Sangat mudah baginya untuk membuat orang lain mengerti dan memurnikan mereka. Dia memiliki hanya sedikit keinginan, kemarahan, atau angan-angan khayalan. Dia juga berpikiran terbuka, dan sekarang menderita karena dia belum pernah mendengar Dharma. Dia mengajarkan para śrāvaka-nya dalam praktek perilaku disiplin yang mengarah ke keadaan di mana tiada 'tanggapan penglihatan' maupun tiada 'yang tanpa tanggapan penglihatan' (naivasamj˝ānāsamj˝āyatanasahavratāyai). Sekarang, di manakah dia tinggal berdiam? "

Pada saat itu sang Tathāgata menyadari bahwa Rudraka meninggal dunia hanya satu minggu yang lalu. Para devatā, juga, menundukkan kepala mereka ke kaki sang Tathāgata dan berkata, "Itu adalah begitu, Bhagavan. Itu adalah begitu, Sugata. Rudraka, sang putra dari Rāma, meninggal dunia hanya satu minggu yang lalu. "

Para Bhikshu, pada saat itu Saya punya pikiran ini: "Sayang, bahwa Rudraka, sang putra dari Rāma, meninggal sebelum mendengar Dharma yang disiapkan dengan baik ini! Kalau saja ia telah menerima ajaran Saya, ia pasti akan mengerti hal itu. Kepadanya seharusnya Saya akan menjelaskan Dharma ini untuk pertama kalinya, dan ia tidak akan berbalik melawan Saya. "

Para Bhikshu, sang Tathāgata kembali memiliki pikiran ini: "Sekarang, dimanakah mungkin ada makhluk lain yang murni dan mudah untuk dilatih? Siapa yang akan memiliki semua kualitas ini dan tidak melawan ajaran Dharma?"

Para Bhikshu, sang Tathāgata kemudian memiliki pikiran ini: "Arādah Kālāpah adalah murni dan memiliki semua kualitas lainnya. Dia tidak akan melawan ajaran Dharma. "Jadi sang Tathāgata bertanya-tanya," Di manakah ia berada sekarang? "Sedang bertanya-tanya, Dia menyadari bahwa Arādah Kālāpah telah meninggal dunia hanya tiga hari yang lalu.

Para devatā dari śuddhāvāsakāyikā lebih lanjut menjelaskan hal itu kepada sang Tathāgata, dengan mengatakan: "Itu adalah begitu, Bhagavan. Itu adalah begitu, Sugata. Arādah Kālāpah meninggal dunia hanya tiga hari yang lalu."

Sang Tathāgata kemudian berpikir: "Sayang, bahwa Arādah Kālāpah meninggal dunia sebelum mendengar Dharma yang disiapkan dengan baik ini!"

Para Bhikshu, pada saat itu sang Tathāgata sekali lagi merenungkan: "Makhluk lain apakah yang murni, memiliki hati yang baik dan semua kualitas, dan tidak akan melawan ajaran Dharma Saya?"

Para Bhikshu, sang Tathāgata kemudian memiliki pikiran ini: "Lima pertapa sahabat Saya (pa˝cakā bhadravargīyāh) adalah murni dan baik hati. Mereka akan menjadi guru yang baik yang mampu memurnikan orang lain. Mereka memiliki hanya sedikit keinginan, kemarahan, angan-angan khayalan. Mereka akan berpikiran terbuka, dan mereka sekarang menderita karena belum mendengar Dharma. Ketika Saya sedang berlatih dalam kesulitan, mereka membantu Saya. Mereka akan memahami Dharma yang diajarkan oleh Saya, dan mereka tidak akan melawan Saya. "

Para Bhikshu, pada saat itu sang Tathāgata memutuskan: "Lima pertapa sahabat Saya akan menjadi orang-orang yang Saya ajarkan Dharma untuk pertama kalinya!"

Para Bhikshu, sang Tathāgata sekarang berpikir lebih lanjut: "Dimanakah lima pertapa sahabat ini mungkin tinggal berdiam?"

Memeriksa seluruh dunia dengan buddhacaksu-Nya, Dia melihat lima pertapa sahabat itu tinggal di Taman Rusa, Varanasi, dekat Bukit Gugurnya Para Resi.

Setelah melihat ini, Dia berpikir pada Diri-Nya Sendiri: "Jika Saya mengajarkan Dharma kepada lima pertapa yang sangat baik ini sebelum Saya mengajar orang lain, mereka akan mengerti Dharma Saya ketika Saya mengajar untuk pertama kalinya."

Kenapa begitu? Para Bhikshu, mereka telah berlatih dan mereka sudah memiliki kualitas yang murni dari pandita yang mahir. Mereka bertujuan pada 'jalan menuju pembebasan (moksamārgā)' dan terbebas dari kekuatan penghalang.

Sekarang, para Bhikshu, setelah merenungkan dalam cara ini, sang Tathāgata bangkit dari kursi kebangkitan, menguncang trisāhasramahāsāhasrah lokadhātu. Pada waktu melewati negara Magadha, Dia berangkat dalam perjalanan ke kāśi. Dalam Gayā, tidak jauh dari kursi kebangkitan, sang pertapa Ājīvika melihat Dia dari jauh. Melihat sang Tathāgata mendekat, ia datang kepada-Nya dan berdiri di satu sisi.

Saat ia berdiri di satu sisi, para Bhikshu, Ājīvika pertama membuat percakapan yang menyenangkan tentang berbagai hal dengan sang Tathāgata, dengan mengatakan: "Ayusman Gautama, indera Anda tenang, dan kulit Anda cerah, murni, dan berwarna kuning. Sama seperti musim gugur, yang putih dan cerah, menjadi berwarna kuning, indera Anda, Gautama, adalah cerah, dan wajah bulat Anda adalah murni sempurna. Sama seperti ketika buah matang dari pohon tāla ini merusak batangnya, daerah yang terputus itu segera menjadi kuning, cerah, dan murni sempurna, jadi, Gautama, demikian juga indera yang cerah dan wajah bulat yang murni sempurna milik Anda. Sama seperti kalung yang terbuat dari emas dari sungai Jambu, yang permukaannya memiliki keunggulan dari bintang yang bersinar, ketika dibentuk dengan baik oleh anak yang terampil dari seorang tukang emas dan dilemparkan ke atas kain putih menjadi berwarna hidup, gemilang, murni sempurna, dan sangat cerah, demikian juga, Ayusman Gautama, dengan indera yang tenang, warna kulit yang cerah, dan wajah bulat yang murni sempurna milik Anda. Ayusman Gautama, dengan siapakah Anda berlatih brahmacarya? "

Para Bhikshu, sang Tathāgata menjawab Ājīvika dengan syair-gātha ini:

"Saya tidak memiliki guru apapun;
Tidak ada yang seperti Saya.
Saya sendiri adalah Sambuddhah,
'Yang menakjubkan (śītībhūto)' dan 'tanpa cacat (nirāśravah)'. "

Ia kemudian berkata: "Gautama, pasti Anda tidak mengatakan bahwa Anda telah menjadi Arahan? "

Sang Tathāgata menjawab:

"Saya adalah Arahan dunia;
Guru yang tiada tandingan (śāstā hyahamanuttarah).
Di antara para dewa, asura, dan gandharva,
Tidak ada yang menandingi Saya. "

Ia bertanya: "Gautama, pasti Anda tidak mengatakan bahwa Anda telah menjadi Jina? "

Sang Tathāgata menjawab:

"Para Jina harus diketahui sama seperti Saya,
Yang telah menghabiskan semua kesalahan.
Saya telah mengalahkan semua dharma yang jahat;
Oleh karena itu, teman, Saya memang adalah Jina. "

Ia bertanya lagi: "Ayusman Gautama, kemanakah Anda akan pergi sekarang?"

Sang Tathāgata menjawab:

"Saya dalam perjalanan ke Vārānasī.
Ketika Saya tiba di kota Kāśi,
Saya akan memancarkan cahaya yang tidak tertandingi
Bersinar di dunia ini pada yang buta.

"Saya dalam perjalanan ke Vārānasī.
Ketika Saya tiba di kota Kāśi,
Saya akan memukul genderang besar dari nektar
Terdengar di dunia ini pada yang tuli.

"Saya dalam perjalanan ke Vārānasī.
Ketika Saya tiba di kota Kāśi,
Saya akan memutar Roda Dharma
Yang belum pernah diputar di dunia ini. "

"Semoga ini terjadi, Gautama!" Jawab Ājīvika. "Semoga ini terjadi!" Pertapa itu kemudian berangkat ke arah selatan sedangkan sang Tathāgata pergi ke arah utara.

Para Bhikshu, pada saat ini, Sudarsana, sang rāja nāga, mengundang sang Tathāgata untuk tinggal berdiam bersamanya di Gaya untuk beberapa jamuan. Sang Tathāgata kemudian melanjutkan ke Rohitavastu dan menuju ke kota Urubilvākalpa, Anāla, dan Sārathi. Para Bhikshu, di semua tempat itu para orang awam mengundang sang Tathāgata untuk tinggal berdiam dan menyegarkan diri-Nya.

Pada waktunya, Dia tiba di tepi sungai Gangga yang besar (gangā mahānadī). Para Bhikshu, pada waktu itu air sungai Gangga yang besar terlalu tinggi dan mengalir pada ketinggian yang sama dengan tepinya. Sekarang, para Bhikshu, karena sang Tathāgata ingin menyeberangi sungai, Dia mendekati 'tukang perahu (nāvika)' tentang hal ini.

Tukang perahu berkata kepada-Nya, "Gautama, Anda harus membayar biaya penyeberangan."

Sang Tathāgata menjawab, "Tuan, Saya tidak memiliki cara apapun untuk membayar biaya penyeberangan." Lalu Dia terbang melalui udara dari satu tepi ke yang lainnya.

Ketika tukang perahu melihat ini, ia merasa menyesal, berpikir, "Oh tidak, sangat sayang! Bagaimana saya bisa menolak untuk memberikan tumpangan perahu kepada 'Dia Yang Patut Dihormati (daksinīyo)' yang layak dilayani! "ia kemudian pingsan dan jatuh ke tanah.

Kemudian tukang perahu menceritakan kisah itu kepada Raja Bimbisārā: "Yang Mulia, ketika saya meminta sang Sramanah Gautama untuk membayar biaya penyeberangan, Dia memberitahukan kepada saya bahwa Dia tidak memiliki uang untuk membayar ongkos itu. Sebaliknya Dia hanya terbang melalui udara dari satu tepi sungai ke tepi sungai yang lainnya! " Ketika Raja Bimbisārā mendengar ini, dia membebaskan biaya penyeberangan untuk semua Pravrajitā mulai dari hari itu dan seterusnya.

Para Bhikshu, dalam cara ini sang Tathāgata melintasi negeri itu. Akhirnya Dia tiba di kota besar Varanasi (vārānasī mahānagarī). Saat fajar, Dia berpakaian, mengenakan jubah cīvara, dan mengambil mangkuk pindā-Nya. Kemudian Dia masuk ke kota Varanasi untuk melakukan pindapātra. Segera Dia telah memperoleh cukup persembahan dan duduk untuk makan.

Dia kemudian melanjutkan ke bukit gugurnya orang bijak di taman rusa untuk menemui lima pertapa sahabat-Nya (pa˝cakā bhadravargī) sebelumnya. Lima pertapa sahabat itu bisa melihat sang Tathāgata sedang mendekat dari kejauhan, dan mereka mulai merencanakan:

"Ayusmantah, lihat, inilah sang Sramanah Gautama, yang malas, rakus, yang telah menyerah dari praktek pertapaan. Sebelumnya, ketika Dia berlatih 'pertapaan yang sulit (duskaracarya)', Dia tidak pernah berhasil mewujudkan kebijaksanaan yang mendalam yang berasal dari ajaran manusia yang unggul. Berapa banyak yang lebih buruk lagi sekarang! Dia tidak akan ditiru saat Dia berjalan di sekitar makan makanan yang tepat dan melakukan praktek yang mudah. Sang rakus yang malas! Tidak satu pun dari kita akan mendekati-Nya untuk menyambut-Nya atau bangun ketika Dia datang. Jangan membantu-Nya dengan memegang jubah cīvara-Nya atau mangkuk pindā-Nya. Jangan menawarkan Dia makanan atau minuman untuk penyegaran, atau tempat untuk mengistirahatkan kaki-Nya. Kita bisa, bagaimanapun, menyiapkan beberapa kursi kosong dan berkata: "Ayusman Gautama, ini adalah kursi cadangan. Jika Anda suka, Anda dapat duduk."Ayusmā Āj˝āna Kaundinya tidak setuju dengan hal ini, tapi ia juga tidak menyuarakan penentangannya.

Para Bhikshu, semakin dekat sang Tathāgata datang ke lima petapa sahabat-Nya sebelumnya, semakin tidak nyaman mereka rasakan di kursi mereka dan ingin berdiri. Mereka merasa seperti burung yang terperangkap dalam kandang dengan api membakar di bawah.

Sama seperti burung yang tersiksa oleh api hanya ingin bangkit dengan cepat dan terbang jauh, semakin dekat sang Tathāgata datang ke lima petapa sahabat-Nya, semakin tidak nyaman mereka rasakan di kursi mereka dan ingin bangun. Alasan mereka merasa dalam cara ini adalah bahwa tidak ada makhluk hidup yang dapat tetap duduk ketika melihat sang Tathāgata. Jadi semakin dekat sang Tathāgata datang ke lima petapa sahabat-Nya, semakin besar kemegahan dan cahaya-Nya menjadi. Mereka mulai gemetar di kursi mereka, dan kemudian rencana mereka sebelumnya sekarang menjadi runtuh sepenuhnya dan mereka semua berdiri dari kursi mereka.

Satu orang pergi untuk menyambut-Nya. Satu orang mendekati-Nya dan memegang jubah cīvara-Nya dan mangkuk pindā-Nya. Satu orang mempersiapkan kursi untuk-Nya. Satu orang membuat sandaran kaki. Satu orang membawa air untuk mencuci kaki-Nya dan berkata, "Selamat datang, Yang Mulia Gautama! Selamat Datang, Yang Mulia Gautama! Silahkan duduk di kursi yang telah diatur ini. (svāgatam te āyusman gautama, svāgatam te āyusman gautam| nisīdedamāsanam praj˝aptam)"

Para Bhikshu, sang Tathāgata memang duduk di kursi yang telah diatur itu, dan lima petapa sahabat, yang mencoba untuk membuat percakapan yang beragam, gembira, dan menyenangkan dengan sang Tathāgata, duduk agak terpisah. Mereka berbicara kepada sang Tathāgata dengan cara yang sama dengan Ājīvika yang telah menyapa-Nya sebelumnya: "Ayusman Gautama, indera Anda tenang, dan kulit Anda cerah, murni, dan berwarna kuning. Sama seperti musim gugur, yang putih dan cerah, menjadi berwarna kuning, indera Anda, Gautama, adalah cerah, dan wajah bulat Anda adalah murni sempurna. Sama seperti ketika buah matang dari pohon tāla ini merusak batangnya, daerah yang terputus itu segera menjadi kuning, cerah, dan murni sempurna, jadi, Gautama, demikian juga indera yang cerah dan wajah bulat yang murni sempurna milik Anda. Sama seperti kalung yang terbuat dari emas dari sungai Jambu, yang permukaannya memiliki keunggulan dari bintang yang bersinar, ketika dibentuk dengan baik oleh anak yang terampil dari seorang tukang emas dan dilemparkan ke atas kain putih menjadi berwarna hidup, gemilang, murni sempurna, dan sangat cerah, demikian juga, Ayusman Gautama, dengan indera yang tenang, warna kulit yang cerah, dan wajah bulat yang murni sempurna milik Anda. Ayusman Gautama, dengan siapakah Anda berlatih brahmacarya? "

Sang Tathāgata menjawab lima pertapa sahabat dengan cara berikut: "Para Bhikshu, Anda harus tidak menyapa sang Tathāgata dengan kata: 'āyusma', yang berarti 'usia terbatas (Ayus-ima)'. Semoga tidak lama Anda segera mendapatkan tujuan, kesejahteraan, dan kebahagiaan Anda. Para Bhikshu, Saya telah mewujudkan 'keabadian (amrtam)' dan jalan yang mengarah ke keabadian (sāksātkrto'mrtagāmī ca mārgah). Para Bhikshu, Buddha adalah Saya (buddho'hamasmi), Yang Mengetahui Semua (sarvaj˝ah), Yang Melihat Semua (sarvadarśī). Saya telah menjadi hening-tenang dan telah menghabiskan semua noda batin (śītībhūto'nāśravah).

"Para Bhikshu, menjadi Penguasa 'semua gejala kejadian (sarvadharmesu)', Saya akan mengajarkan Anda Dharma. Mari, dengarlah dan pahamilah. Dengarkan dengan saksama dengan telinga terbuka, dan Saya akan memberikan ajaran dan bimbingan. Ketika saya mengajar dan membimbing Anda, Anda juga akan melepaskan semua noda batin dan terbebaskan dalam keadaan pikiran yang tanpa noda dan bijaksana. Ketika Anda mencapai 'Keadaan dari Bhikshu Suci (upasampadya)', Anda akan memberitakan: 'Kelahiran kami telah habis (jātirusitam). 'Kehidupan suci (brahmacaryam)' telah terjalani. Apa yang harus dilakukan telah dilakukan - dan tidak ada yang lain. Oleh karena itu Kita tahu keberadaan berbeda dari kehidupan biasa ini. "

"Tidakkah kalian, para Bhikshu, sebelumnya mengatakan kepada diri kalian sendiri: "Ayusmantah, lihat, inilah sang Sramanah Gautama, yang malas, rakus, yang telah menyerah dari praktek pertapaan. Sebelumnya, ketika Dia berlatih 'pertapaan yang sulit (duskaracarya)', Dia tidak pernah berhasil mewujudkan kebijaksanaan yang mendalam yang berasal dari ajaran manusia yang unggul. Berapa banyak yang lebih buruk lagi sekarang! Dia tidak akan ditiru saat Dia berjalan di sekitar makan makanan yang tepat dan melakukan praktek yang mudah. Sang rakus yang malas! Tidak satu pun dari kita akan mendekati-Nya untuk menyambut-Nya atau bangun ketika Dia datang. Jangan membantu-Nya dengan memegang jubah cīvara-Nya atau mangkuk pindā-Nya. Jangan menawarkan Dia makanan atau minuman untuk penyegaran, atau tempat untuk mengistirahatkan kaki-Nya. Kita bisa, bagaimanapun, menyiapkan beberapa kursi kosong dan berkata: "Ayusman Gautama, ini adalah kursi cadangan. Jika Anda suka, Anda dapat duduk."

Para Bhikshu, segera setelah sang Tathāgata telah mengucapkan kata-kata ini, semua simbol tirthika (tīrthikalingam) dan spanduk tirthika (tīrthikadhvajah) yang lima pertapa sahabat sedang pakai menghilang dalam sekejap. Sebaliknya mereka masing-masing sekarang menemukan diri mereka sedang memakai 'tiga jubah suci (tricīvaram)' dengan 'mangkuk (pātra)' dan kemudian tercukur habis rambut kepala (tadanu chinnāśca keśāh). Bahkan perilaku mereka seolah-olah mereka sudah di-upasampada selama seratus tahun. Ini benar-benar adalah "pengembaraan (pravrajyā)" mereka; Seluruh Upasampada ini menjadi 'intisari dari Bhikshu (bhiksubhāvah)'.

Para Bhikshu, segera Pa˝cakā Bhadravargīyā itu membungkuk ke kaki sang Tathāgata dan mengakui perilaku mereka yang salah. Di hadapan sang Tathāgata, mereka menghasilkan pengakuan mereka tentang Dia sebagai guru mereka, serta cinta, pengabdian, dan hormat mereka kepada-Nya. Berdasarkan pengabdian, mereka kemudian memberi sang Tathāgata mandi yang menyegarkan dan bersih di kolam bunga teratai dengan bunga teratai dari berbagai macam warna.

Para Bhikshu, setelah sang Tathāgata telah disegarkan dengan mandi itu, Dia berpikir pada Diri-Nya Sendiri: "Bagaimanakah para Tathāgata Arhad Samyaksambuddha masa lampau memutar Roda Dharma?" Para Bhikshu, di manapun para Tathāgata Arhad masa lampau, memutar Roda Dharma, di tempat itu ada muncul 'seribu takhta permata yang terbuat dari tujuh jenis permata (saptaratnamayamāsanasahasram)'. Maka sang Tathāgata, berdasarkan penghormatan kepada para Tathāgata masa lampau, melakukan pradaksina pada tiga takhta pertama dan kemudian duduk bersila di atas takhta keempat sama seperti Singa yang tidak kenal takut. Lima Bhikshu itu bersujud kepada sang Tathāgata dengan kepala mereka di kaki-Nya dan kemudian duduk di depan-Nya.

Para Bhikshu, pada saat itu tubuh sang Tathāgata mulai memancarkan sinar cahaya yang mengisi trisāhasra mahāsāhasra lokadhātu ini dengan cahaya terang. Cahaya ini menerangi penduduk seluruh dunia yang terrendam dalam kejahatan dan kegelapan. Warna dan kecemerlangan cahaya ini bahkan melampaui milik matahari dan bulan, planet-planet magis itu yang begitu sangat dipuji karena kekuatan besar mereka. Cahaya itu bersinar begitu terang sehingga menerangi bahkan tempat-tempat yang begitu gelap bahwa para makhluk yang lahir di sana tidak bisa melihat tangan mereka sendiri, bahkan jika mereka memegang tepat di depan wajah mereka. Sekarang bahkan para makhluk itu bermandikan cahaya yang sangat terang sehingga mereka segera melihat dan mengakui satu sama lain, dengan mengatakan, "Oh, ada makhluk lain di sini! Mereka sungguh ada! "

Maka seluruh trisāhasra mahāsāhasra lokadhātuh berguncang enam cara yang berbeda dan memperlihatkan delapan belas tanda-tanda yang besar (astādaśamahānimittamabhūt). Ini mulai gemetar, bergetar, gempa, bergoyang, bergemuruh guntur, dan mengaum, masing-masing dalam tiga tingkat kekuatan. Dunia bergetar sangat keras bahwa ketika tepi turun, pusat naik; ketika tepi naik, pusat turun; Ketika timur turun, barat naik; ketika barat naik, timur turun; ketika utara turun, selatan naik; ketika utara naik, selatan turun.

Pada saat itu, orang bisa mendengar segala macam suara yang menyenangkan dan ceria. Ada suara yang membangkitkan cinta kasih dan membuat semua orang menjadi tenang. Ada suara yang mengundang dan menyegarkan yang mustahil untuk digambarkan atau ditiru, suara menyenangkan yang tidak menghasilkan rasa takut. Pada saat itu, tidak ada satu makhluk pun yang merasa bermusuhan, takut, atau cemas. Pada saat itu bahkan cahaya matahari dan bulan dan kemegahan para dewa, seperti Sakra, Brahma, dan Lokapālā, tidak bisa terlihat lagi. Semua makhluk yang sedang hidup di neraka bersama dengan mereka yang lahir sebagai hewan dan semua yang ada di dalam dunia 'tuan kematian (yama)' menjadi seketika bebas dari penderitaan dan dipenuhi dengan semua kebahagiaan. Tidak ada yang memiliki emosi, seperti kebencian, kebodohan, iri, dengki, sombong, munafik, angkuh, amarah, dendam, atau kesedihan yang membakar. Pada saat itu semua makhluk merasakan cinta kasih untuk satu sama lain, berharap yang baik untuk satu sama lain, dan melihat satu sama lain sebagai orang tua dan anak-anak. Kemudian, dari dalam susunan cahaya itu, syair-gātha ini berbunyi:

"Pergi meninggalkan surga tusitā, (yo'sau tusitālayāccyutvā)
Berangkat kedalam rahim Ibu, (okrāntu mātukuksau hi)
Mengambil kelahiran di hutan lumbini, (jātaśca lumbinivane)
Dan diangkat oleh suami Saci. (pratigrhītah śacīpatinā)

"Dengan kiprah Singa, (yah simhavikramagatih)
Mengambil tujuh langkah tanpa gangguan, (saptapadā vikramī asammūdhah)
Berbicara dengan suara seperti Brahma : (brahmasvarāmatha giram pramumoca)
"Sayalah yang paling unggul di dunia." (jagatyaham śresthah)

"Meninggalkan empat benua dan menjadi pertapa, (caturo dvīpāmstyaktvā pravrajitah)
Demi menolong semua makhluk. (sarvasattvahitahetoh)
Mulai mempraktekkan pertapaan yang sulit, (duskaratapaścaritvā)
Sebelum pergi ke kursi tengah pusat bumi. (upāgamadyena mahimandah)

"Menaklukkan Mara dan pasukannya, (sabalam nihatya māram)
Memperoleh kebangkitan demi dunia. (bodhiprāpto hitāya lokasya)
Telah datang ke Varanasi (vārānasīmupagato)
Untuk memutar Roda Dharma. (dharmacakram pravartayitā)

"Brahma dan dewa lainnya meminta-Nya (sabrahmanā saha surairadhyesto)
Memutar Roda keseimbangan. (vartayasva śamacakram)
Di setujui oleh sang Muni (adhivāsitam ca muninā)
Melahirkan kasih sayang kepada dunia. (loke kārunyamutpādya)

"Dengan menjaga janji-Nya yang kuat, (so'yam drdhapratij˝o)
Telah datang ke Varanasi di Taman Rusa. (vārānasimupagato mrgadāvam)
Di sana sang 'Tuan (śrīmān)' akan memutar Roda
Yang menakjubkan, mulia, dan tidak tertandingi.

"Jika menginginkan Dharma, (yah śrotukāmu dharmam)
Yang setelah seratus miliar kalpa diperoleh sang Pemenang. (kalpanayutaih samārjitu jinena)
Segera cepat datang tepat waktu (śīghramasau tvaramāno āgacchatu)
Untuk mendengarkan Dharma. (dharmaśravanāya)

"Sungguh langka memperoleh kehidupan manusia dan munculnya seorang Buddha, (duravāpyam mānusyam buddhotpādah)
Lebih sangat langka lagi keyakinan. (sudurlabhā śraddhā)
Kebebasan dari delapan keadaan yang malang sangat langka diperoleh, (astāksanavivarjana durāpāh)
Yang paling unggul adalah mendengarkan Dharma. (śrestham ca dharmaśravanam)

"Telah diperoleh hari ini semuanya itu: (prāptāśca te'dya sarve)
Buddha telah muncul, kebebasan dimiliki serta keyakinan. (buddhotpādah ksanastathā śraddhā)
Mendengar Dharma adalah yang terbaik (dharmaśravanaśca varah)
Tinggalkanlah kecerobohan yang menggila. (pramādamakhilam vivarjayata)

"Anda pada keadaan setiap waktu, (bhavati kadācidavasthā)
Selama miliaran kalpa belum pernah mendengar Dharma. (yah kalpanayutairna śrūyate dharmah)
Telah muncul itu hari ini (samprāptah sa ca vādya)
Tinggalkanlah kecerobohan yang menggila. (pramādamakhilam vivarjayata)

"Kelompok deva bumi diperintahkan (bhaumādīn devaganān samcodayatī)
Serta sampai hingga Brahma (ca brahmaparyantām)
Datanglah segera semuanya berangkatlah! (āyāta laghum sarve vartayitā)
Sang Pemandu akan memutar Roda Keabadian. (nāyako hyamrtacakram)

Saat suara kedewaan yang agung memanggil, (samcoditāśca mahatā devaghosena)
Pada waktu seketika itu juga semuanya, (tatksanam sarve)
Setelah meninggalkan kekayaan dewa, (tyaktvā devasamrddhim)
Hadir kepada sang Buddha disamping-Nya. (prāptā buddhasya te pārśve)

Para Bhikshu, agar sang Tathāgata memutar Roda Dharma di Taman Rusa dekat Bukit Gugurnya Para Resi di Varanasi, para dewa bumi sekarang membentuk 'lingkaran besar (mahā mandala)' di sekeliling sang Tathāgata. itu sangat bagus dan indah dipandang mata. Itu sangat besar dengan bundaran tujuh ratus yojana panjangnya, dan para dewa menghiasi langit di atas dengan payung, bendera kemenangan, spanduk, dan kanopi.

Para devaputra dari 'alam nafsu keinginan (kāmāvacarai)' dan 'alam bentuk rupa (rūpāvacaraiśca)' kemudian mempersembahkan kepada sang Tathāgata '8,4 juta takhta singa (caturaśītisimhāsanaśatasahasrāni)', disertai dengan permohonan ini: "Tolong pikirkan kami dengan cinta kasih dan ambil tempat duduk Anda di atas takhta ini. Kami berdoa memohon sang Bhagavān untuk memutar Roda Dharma."

Para Bhikshu, pada waktu itu dari semua penjuru arah - timur, selatan, barat, dan utara, di atas dan di bawah - banyak jutaan para Bodhisattva (bahavo bodhisattvakotyah) yang telah membuat 'cita-cita (pranidhāna)' sebelumnya untuk kesempatan ini datang hadir. Mereka semua membungkuk ke kaki sang Tathāgata dan meminta-Nya untuk memutar Roda Dharma. Dari trisāhasra mahāsāhasra lokadhātu, para Sakra, Brahmā, Lokapālā, dan yang lainnya dengan mereka yang terkenal sebagai penguasa besar dari penguasa besar (maheśākhyamaheśākhyā), para devaputrā itu semuanya menundukkan kepala mereka ke kaki sang Tathāgata. Mereka semua meminta sang Tathāgata untuk memutar Roda Dharma dengan kata-kata ini:

"Putarlah, Bhagavān, Roda Dharma. Putarlah, Sugato, Roda Dharma. (pravartayatu bhagavān dharmacakram, pravartayatu sugato dharmacakram). Demi keuntungan orang banyak (bahujanahitāya), demi kebahagiaan orang banyak (bahujanasukhāya), untuk belas kasihan kepada dunia (lokānukampāyai), untuk kesejahteraan dan kebahagiaan orang banyak, para dewa dan manusia (mahato janakāyasyārthāya hitāya sukhāya devānām ca manusyānām ca). Bhagavan, tolong buatlah 'persembahan Dharma (dharmayaj˝am)', turunkanlah hujan Dharma (pravarsa mahādharmavarsam)! Tegakkanlah bendera besar kemenangan Dharma (ucchrepaya mahādharmadhvajam)! Tiuplah keong Dharma yang besar (prapūraya mahādharmaśankham)! Pukullah genderang Dharma yang besar (pratādaya mahādharmadundubhim)! "

Dari mana-mana di trisāhasra mahāsāhasra lokadhātu ini, para Brahma, Sura, dan Pālā bermunculan.
Menundukkan kepala mereka kepada sang 'Pemenang (Jina)', mereka mengatakan:
"Tolong ingat janji Anda sebelumnya (smara pūrvapratij˝ām), Mahā Muni. Sebelumnya Anda mengatakan,
'Sayalah 'yang pertama (jyesthu)' dan 'yang terbaik (viśistu)', yang mengakhiri penderitaan makhluk (prajāya karisye dukhasya ksayam).

Anda mengalahkan Mara dan pasukannya, saat duduk di Raja Pohon, Muni. (tvaya dharsitu mārū sasainyu drumendri sthihitva mune)
Terbangkitkan pada Kebangkitan Tertinggi yang sepenuhnya hening-tenang, menghancurkan pohon emosi yang mengganggu, (varabodhi vibuddha suśānti nipātita kleśadrumāh)
Tujuan telah tercapai sepenuhnya, yang telah dipelihara selama seratus kalpa. (abhiprāyu prapūrna aśesa ya cintita kalpaśatā )
Lihatlah pada para makhluk yang tanpa Pembimbing, putarlah Roda Tertinggi. (janatām prasamīksya anāyika vartaya cakravaram)"

Cahaya dari sang Sugata menerangi ratusan ribu alam, (sugatasya prabhāya prabhāsita ksetrasahasraśatā)
Menyebabkan ratusan para putra Buddha tiba secara kekuatan ajaib, (bahavah śatabuddhasutāśca upāgata rddhibalaih)
Membuat sangat banyak pemujaan kepada sang Sugata dengan keanekaragaman yang besar. (vividhām sugatasya karitvana pūja mahānicayām)
Memuji kualitas murni sang Tathagata, memohon Dia yang berbelas kasih (stavayimsu tathāgatu bhūtagunebhi adhyesitu kārunikam):

"Seperti awan belas kasih (karunāghana), petir kebijaksanaan (vidyutapraj˝a), dan angin wawasan (vāyusamā),
Selama seribu kalpa, Anda telah memelihara semua makhluk dengan 'suara gemuruh Anda (abhigarjitu)'.
Tolong tenangkan kehausan mereka dengan hujan dari awan delapan bagian jalan (astāngikamārgajalo);
Semoga kekuatan (bala), indera (indriya), dan konsentrasi (dhyāna) Anda membuat panen pembebasan yang melimpah (vimoksa vivardhaya sasyadhanam).

"Selama banyak ribuan kalpa (bahukalpasahasra), Anda telah 'terlatih dengan baik (suśiksitu)' dan tinggal berdiam dalam intisari kekosongan (śūnyatattva sthitā);
Mencapai Obat dari Dharma (samudānitu dharmaju bhesaju) dan mengetahui kehidupan makhluk hidup (jānitu sattvacarī).
Untuk manusia yang tersiksa oleh seratus penyakit emosi yang mengganggu, (janatā iya vyādhiśatebhi upadruta kleśaganaih)
Sang Jina Penyembuh akan membebaskannya dan memutar Roda Dharma Tertinggi. (jinavaidya pramocaya vartaya dharmacakravaram)

"Dalam waktu yang lama Anda meningkatkan Sad-Pāramita;
Anda melaksanakan dan mengumpulkan kekayaan yang tidak tertandingi dan yang abadi dari Dharma.
Seperti Anda melihat semua makhluk ini yang tanpa perlindungan, kekayaan, atau bimbingan,
Pemimpin Mulia (vināyaka), tolong bagikan tujuh jenis kekayaan dan putarlah Roda.

"Anda dengan gembira melepaskan keberuntungan, kekayaan, harta, emas, jubah yang indah,
bunga-bunga indah, salep, bubuk wangi,tempat tinggal terbaik, rombongan istri, kerajaan, bahkan anak tercinta,
Demi mencari 'kebangkitan (bodhi)' dari para Pemenang.
Buddha yang sempurna, putarlah Roda tertinggi. (sātivibuddha pravartaya cakravaram)

"Selama seratus kalpa Anda telah juga terus menjaga 'disiplin (sila)' tetap utuh dan murni,
Selalu melatih 'kesabaran (ksānti)' dan dengan 'ketekunan (vīrya)' Anda yang tidak pernah berkurang.
Muni, 'konsentrasi (dhyāna)', 'pengetahuan super (abhij˝a)', 'wawasan kedalam kenyataan (vipaśyana)', 'kebijaksanaan (praj˝a)', 'keseimbangan batin (upeksa)' Anda adalah yang tertinggi;
Dengan niat Anda tercapai, lenyapkanlah penyakit dan putarlah Roda tertinggi. "



Dharma Chakra

Para Bhikshu, pada saat itu sang Bodhisattva Mahāsattva yang bernama 'Memutar Roda Dharma Ketika Tekad Terbentuk (sahacittotpādadharmacakrapravartī)', mempersembahkan 'Roda (cakram)' kepada sang Tathāgata. Itu adalah Roda indah yang dihiasi dengan semua permata (sarvaratnapraśobhitam), terhiasi dengan berbagai jenis permata, dan susunan perhiasan (nānāratnālamkāravyūhavibhūsitam), memiliki pusat roda, lingkaran dan seribu jari-jari, dihiasi dengan karangan bunga (sapuspadāmam), jeruji emas (sahemajālam), jumbai dengan lonceng, dan motif gajah dalam jejak roda, bejana yang penuh, dan swastika. Roda itu dihiasi dengan berbagai tanda keberuntungan, dengan indah dibungkus kain surga dan dicelup dalam berbagai warna, tertaburi dengan bunga-bunga surga, dihiasi dengan karangan bunga yang wangi, dan terolesi dengan salap wangi.

Dalam cara ini, itu adalah Roda yang seindah mungkin. Ini terjadi melalui kekuatan cita-cita masa lampau (pūrvapranidhānābhinirhrtam) yang dibuat saat sang Bodhisattva telah berlatih. Itu benar-benar pemujaan yang sesuai kepada sang Tathāgata. Karena semua Tathāgata masa lampau berturut-turut telah menerima Roda ini, itu memiliki pemberkatan yang tidak terputus dari semua Buddha (sarvabuddhādhisthānāvilopitam). Bahkan Roda ini di masa lalu telah diputar oleh semua Tathāgata Arhadbhih Samyaksambuddha masa lampau, dan oleh karena itu sekarang dipersembahkan kepada sang Tathāgata untuk diputar.

Setelah ia telah membuat persembahannya kepada sang Tathāgata, sang Bodhisattva menggabungkan telapak tangannya beranjali dan memuji sang Tathāgata dengan syair-gātha ini:

"Ketika Dipamkara membuat ramalan untuk sang Suddhasattva,
Dia mengatakan, "Anda akan menjadi Buddha, singa di antara singa laki-laki (narasimhasimhah)."
Pada saat itu saya membuat cita-cita berikut:
"Ketika saya menjadi sambodhi, saya akan mencari Dharma. '

"Hari ini para yang terbaik dari makhluk (āgrasattvāh) telah datang ke sini dari sepuluh penjuru arah,
Begitu banyak jumlahnya sehingga mereka tidak dapat dihitung.
Dengan telapak tangan bergabung beranjali mereka bersujud di Kaki-Nya
Dan meminta sukacita dari sang suku Sakya untuk memutar Roda Dharma.

"Persembahan dari para sura di kursi kebangkitan,
Dan jajaran dari semua putra-putra Jina -
Mereka semua berdiri bersama-sama, menetapkan untuk Roda Dharma.
Jajaran yang lengkap itu tidak akan pernah bisa dijelaskan sepenuhnya.

"Langit di atas trisahasra ini dipenuhi dengan para dewa,
Dan di bumi, para asura, kinnara, dan manusia berkeliaran.
Namun tidak ada suara yang dapat didengar pada saat ini
Saat semua orang melihat dengan pikiran yang tenang pada sang Jina. "

Para Bhikshu, sang Tathāgata sekarang menghabiskan bagian pertama dari malam hari dalam keheningan. Selama bagian dari tengah malam, Dia memberikan bicara yang fasih. Akhirnya, selama bagian terakhir dari malam, Dia memanggil lima pertapa sahabat yang sangat unggul itu dan berkata:

"Para Bhikshu, ada 'dua hal yang sangat berlebihan (dvāvimau)' yang harus anda hindari ketika anda telah menjadi Pravrajita. Pertama jangan mengikuti nafsu kesenangan diri (yaśca kāmesu kāmasukhallikā yogo), yang dangkal (hīno), yang duniawi (grāmyah), yang awam biasa (pārthagjaniko), yang tidak layak untuk Arya (nālamāryo), yang diikuti oleh hasil yang tidak berguna (anarthopasamhito). Dalam jangka panjang hal itu akan mencegah anda dari berlatih brahmacaryā. Anda akan menjadi 'terganggu (nirvide)' dan tidak mampu 'berpisah dari nafsu keinginan (virāgāya)'. Anda tidak akan masuk ke dalam keadaan 'penghentian (nirodhāya)' serta juga tidak akan mengembangkan 'pengetahuan yang lebih tinggi (ābhij˝āya)', atau juga tidak akan mencapai kebangkitan yang sempurna (sambodhaye) serta juga tidak akan mencapai nirvānā. Di sisi lain, menyimpang dari jalan tengah, anda tidak akan berhasil melampaui penderitaan. Jika anda menyiksa tubuh anda hingga menderita dan terluka, anda akan menghadapi kesulitan yang dapat diamati sekarang, dan di masa depan bahkan kesengsaraan lebih lanjut akan jatuh menimpa anda.

"Para Bhikshu, sang Tathāgata mengajarkan Dharma dengan memperlihatkan Jalan Tengah (madhyamayaiva) yang tidak jatuh ke dalam salah satu dari dua hal yang sangat berlebihan itu. Dharma yang Dia ajarkan adalah : pandangan yang benar (samyagdrstih), niat yang benar (samyaksamkalpah), ucapan yang benar (samyagvāk), perbuatan yang benar (samyakkarmāntah), pencaharian penghidupan yang benar (samyagājīvah), usaha yang benar (samyagvyāyāmah), perhatian kesadaran yang benar (samyaksmrtih), dan konsentrasi yang benar (samyaksamādhiriti).

"Ada juga empat, Para Bhikshu, kebenaran yang mulia (catvārīmāni bhiksava āryasatyāni). Apakah keempat itu (katamāni catvāri)? Penderitaan (duhkham), asal mula penderitaan (duhkhasamudayo), berhentinya penderitaan (duhkhanirodho), dan jalan yang mengarah ke berhentinya penderitaan (duhkhanirodhagāminī pratipat).

"Apakah penderitaan itu? kelahiran adalah penderitaan (jātirapi duhkham), menjadi tua adalah penderitaan (jarāpi duhkham), jatuh sakit adalah penderitaan (vyādhirapi duhkham), dan mati adalah penderitaan (maranamapi duhkham). Itu juga termasuk penderitaan dari bertemu yang tidak menyenangkan dan berpisah dari yang menyenangkan (apriyasamprayogo'pi priyaviprayogo'pi duhkham). Tidak menemukan apa yang dicari juga adalah penderitaan (yadapi icchan paryesamāno na labhate tadapi duhkham). Singkatnya lima kumpulan yang berlangsung terus-menerus adalah penderitaan (samksepāt pa˝copādānaskadhā duhkham). Ini adalah apa yang di sebut penderitaan (idamucyate duhkham).

"Apakah asal mula penderitaan itu (tatra katamo duhkhasamudayah)? Itu adalah hasrat keinginan yang melanggengkan keberadaan (yeyam trsnā paunarbhavikī), yang disertai oleh nafsu gairah untuk kesenangan (nandīrāgasahagatā), dan yang menemukan kesenangan di sini dan di sana (tatratatrābhinandinī). Itulah asal mula penderitaan (ayamucyate duhkhasamudayah).

"Apakah berhentinya penderitaan itu (tatra katamo duhkhanirodhah)? Itu adalah hasrat keinginan yang melanggengkan keberadaan, yang disertai oleh nafsu gairah untuk kesenangan, dan yang menemukan kesenangan di sini dan di sana, yang muncul (janikāyā), menjadi lenyap (nirvartikāyā) seluruhnya berpisah dari nafsu (aśeso virāgo) dan terhentikan (nirodhah). Itu adalah berhentinya penderitaan (ayam duhkhanirodhah).

"Apakah jalan yang mengarah ke berhentinya penderitaan itu (tatra katamā duhkhanirodhagāminī pratipat)? Itu sesungguhnya adalah Jalan Delapan Bagian dari para Arya, yaitu (esa evāryāstāngamārgah, tadyathā): Pandangan Yang Benar (samyagdrstih), Niat Yang Benar (samyaksamkalpah), Ucapan Yang Benar (samyagvāk), Perbuatan Yang Benar (samyakkarmāntah), pencaharian penghidupan yang benar (samyagājīvah), usaha yang benar (samyagvyāyāmah), perhatian kesadaran yang benar (samyaksmrtih), sampai dengan (yāvat) Konsentrasi Yang Benar (samyaksamādhiriti). Itu disebut kebenaran Arya yang mengarah ke berhentinya penderitaan (idamucyate duhkhanirodhagāminī pratipadāryasatyamiti).

"Inilah, para Bhikshu, empat kebenaran Arya (imāni bhiksavaścatvāryāryasatyāni).

"Dari 'Penderitaan', Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (iti duhkhamiti me bhiksavah purvamaśrutesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

"Dalam cara dari 'Asal Mula Penderitaan', Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (ayam duhkhasamudaya iti me bhiksavah pūrvamaśrutesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

"Dalam cara dari 'Berhentinya Penderitaan', Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (ayam duhkhanirodha iti me bhiksavah pūrvamaśrutesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

"Dalam cara dari 'Jalan Yang Mengarah ke Berhentinya Penderitaan', Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (ayam duhkhanirodhagāminī pratipaditi me bhiksavah pūrvamaśrutesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

Karena 'Penderitaan' harus dipahami, Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (yatkhalvidam duhkham parij˝eyamiti me bhiksavah pūrvamaśrutesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

Karena 'Asal Mula Penderitaan' harus ditinggalkan, Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (yatkhalvidam duhkhasamudayah prahātavya iti me bhiksavah pūrvamaśrutesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

Karena 'Berhentinya Penderitaan' harus sepenuhnya jelas bisa dimengerti, Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (yatkhalvidam duhkhanirodhah sāksātkartavya iti me bhiksavah pūrvamaśrutesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

Karena 'Jalan Yang Mengarah ke Berhentinya Penderitaan' harus dikerjakan, Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (yatkhalvidam duhkhanirodhagāminī pratipadbhāvayitavyeti me bhiksavah pūrvamaśrutesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

Oleh karena 'Penderitaan' telah dipahami, Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (tatkhalvidam duhkham parij˝ātamiti me bhiksavah pūrvamaśratesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

Oleh karena 'Asal Mula Penderitaan' telah lenyap, Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (tatkhalvidam duhkhasamudayah prahīna iti me bhiksavah pūrvamaśratesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

Oleh karena 'Berhentinya Penderitaan' telah sepenuhnya jelas bisa dimengerti, Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (tatkhalvidam duhkhanirodhah sāksātkrta iti me bhiksavah pūrvamaśratesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

Oleh karena 'Jalan Yang Mengarah ke Berhentinya Penderitaan' telah dikerjakan, Saya, para Bhikshu, yang adalah Dharma yang belum pernah terdengar sebelumnya, memahami'nya' secara bijaksana dan giat menfokuskan kesadaran pikiran pada'nya', dan muncullah pengetahuan, muncullah penglihatan, muncullah kejelasan, muncullah kecerdasan, muncullah akal budi, muncullah kebijaksanaan, cahaya mulai bersinar (tatkhalvidam duhkhanirodhagāminī pratipadbhāviteti me bhiksavah pūrvamaśratesu dharmesu yoniśomanasikārādbahulīkārājj˝ānamutpannam caksurutpannam vidyotpannā bhūrirutpannā medhotpannā praj˝otpannā ālokah prādurbhūtah).

"Para Bhikshu, dengan cara ini Saya sungguh-sungguh merenungkan masing-masing Empat Kebenaran Arya ketika membacanya tiga kali. Namun Saya tidak mengembangkan kebijaksanaan yang melihat dua belas aspeknya. Oleh karena itu, Para Bhikshu, Saya tidak membuat pernyataan bahwa telah mencapai Anuttarāh Samyaksambodhi Abhisambuddha, dan Saya masih belum memiliki 'pengetahuan yang melihat (j˝ānadarśana)'.

"Namun, Para Bhikshu, setelah Saya membaca Empat Kebenaran Arya tiga kali (catursvāryasatyesvevam triparivartam), Saya mengembangkan pengetahuan yang melihat dua belas aspeknya (dvādaśākāram j˝ānadarśanamutpannam). Pada saat itu pikiran Saya terbebaskan (cetovimuktih) dan kebijaksanaan Saya terbebaskan dan menjadi jelas (praj˝āvimuktiśca sāksātkrtā). Pada saat itu, para Bhikshu, Saya menyatakan bahwa telah mencapai Anuttarāh Samyaksambodhi Abhisambuddha. Pengetahuan Saya Yang Melihat telah muncul (j˝ānadarśanam me udapādi), kelahiran Saya telah habis (ksīnā me jātih), praktek kesucian telah terlaksana (usitam brahmacaryam), telah menyelesaikan apa yang perlu dilakukan (krtam karanīyam), dan tidak akan bertumimbal kehidupan lain (nāparasmādbhavam prajānāmi). "

Pada topik ini dikatakan: (tatredamucyate)

Dengan suara Brahma dan auman Kinnara, (vācāya brahmaruta kinnaragarjitāya)
Triliunan sinar cahaya dipancarkan keluar, (amzu sahasranayutebhi samudgatāya)
Selama banyak jutaan kalpa selalu menghargai kebenaran, (bahukalpakoti sada satyasubhāvitāya)
Kata-kata ini dikatakan untuk Kaundinya oleh sang Sakyamuni Yang Muncul Dengan Sendirinya : (kaundinyamālapati śākyamunih svayambhūh)

"Mata adalah tidak kekal dan tanpa dasar demikian juga dengan telinga dan hidung; (caksuranityamadhruvam tatha śrota ghrānam)
Lidah, tubuh, dan pikiran adalah penderitaan, tanpa diri, dan kosong. (jihvā pi kāya mana duhkhā anātma śūnyā)
Sifat alaminya tanpa kehidupan, seperti rumput atau dinding yang tidak aktif; (jadāsvabhāva trnakudya ivā nirīhā)
Tiada diri di sini, tiada orang juga tiada kekuatan hidup. (naivātra ātma na naro na ca jīvamasti)

"Semua gejala kejadian (sarvadharmā) dihasilkan dari sebab-akibat yang saling bergantungan (hetum pratītya sambhuta); á
Melampaui batas (atyanta) dan tanpa kesadaran penglihatan (drstivigatā), sama seperti ruang angkasa (gaganaprakāśā). á
Tidak ada 'perantara (kārako)' demikian juga tidak ada 'yang merasakan (vedako)',
Dan tidak ada 'perbuatan (karma)' yang dapat diamati saat dilakukan, baik atau buruk.

"Penderitaan timbul berdasarkan pada 'kumpulan (skandhā)';
Air hasrat keinginan (trsna salilena) membuatnya bertumbuh besar.
Di Jalan (mārgena), itu dilihat kenyataannya (vipaśyamānā) sebagai 'kesamaan gejala kejadian (dharmasamatāya)';
Secara tanpa berhenti terus menyusut (atyantaksīna) selaras dengan 'sifat alami kehancuran (ksayadharmatayā)', menjadi berhenti (niruddhāh).

"Melalui pemikiran ide gagasan (samkalpakalpajanitena), yang dangkal,
Muncullah 'ketidaktahuan (avidya)'; tiada sumber yang lain.
Ketika melenyapkan 'penyebab pembentukan (samskārahetu)', tiada yang meneruskan (na ca samkramo'sti);
Kesadaran muncul tergantung pada penerusan. (vij˝ānamudbhavati samkramanam pratītya)

"Dari kesadaran, nama dan bentuk muncul keluar; (vij˝āna nāma tatha ca rūpa samutthitāsti)
'Nama' dan 'bentuk' menimbulkan 'enam bidang indera'. (nāme ca rūpi samudenti sadindriyāni)
Saat bergabung dengan enam bidang indera ini, maka 'kontak hubungan' muncul; (sadindiyairnipatito iti sparśa uktah)
'Kontak hubungan' mengakibatkan tiga jenis perasaan.(sparśena tisra anuvartati vedanā ca)

"Bahkan perasaan terkecil seluruhnya juga disertai hasrat keinginan, (yatkimci vedayitu sarva satrsna uktā)
Hasrat keinginan memperoleh semua bentuk penderitaan. (trsnāta sarva upajāyati duhkhaskandhah)
Kemelekatan pada gilirannya meneruskan semua keberadaan, (upādānato bhavati sarva bhavapravrttih)
Bergantung pada keberadaan, timbullah kelahiran. (bhavapratyayā ca samudeti hi jātirasya)

"Disebabkan oleh kelahiran, usia tua - sakit - dan ratapan mengikuti; (jātīnidāna jaravyādhidukhāni bhonti)
Banyak jenis kelahiran di dalam sangkar keberadaan ini. (upapatti naika vividhā bhavapa˝jare'smin)
Demikian juga semua makhluk muncul dari kondisi, (evamesa sarva iti pratyayato jagasya)
Tanpa diri atau orang yang berpindah. (na ca ātma pudgalu na samkramako'sti kaści)

"Siapa pun yang tidak memiliki 'pemikiran (kalpu)' atau 'gagasan yang membeda-bedakan (vikalpu)' telah menemukan 'Jalan (yani)';
Yang telah menemukan 'Jalan (yani)' tidak memiliki 'ketidaktahuan (avidya)'.
Siapa pun yang telah menghentikan ketidaktahuan,
Semua bentuk keberadaan yang menyusut hingga binasa (sarve bhavānga ksayaksīna ksayam) menjadi terhentikan (niruddhā).

"Kondisi sebab-musabab yang demikian itu (evamesa pratyayata), oleh sang Buddha, sang Tathāgata, sang Svayambhu,
Telah dipotong putus terpisah dari dalam Diri-Nya. (svakamātmanu vyākaroti)
Tiada kumpulan (skandha) - indera (āyatana) - unsur (dhātu) untuk mengacu sang Buddha ;
Hanya Dia yang mengetahui asal sebab-musabab dinyatakan sebagai Buddha (nānyatra hetvavagamādbhavatīha buddhah).

"Tiada tempat di sini untuk para tīrthika dari ajaran lain;
Kekosongan telah diumumkan (śūnyā pravādi) disini, pada praktek-yoga dari Dharma (iha īdrśa dharmayoge).
Makhluk-makhluk yang cukup beruntung memahami Dharma ini
Adalah mereka yang belajar dan dimurnikan di dalam bimbingan para Buddha masa lampau. "

Ketika bersama dengan dua belas aspeknya, (evam hi dvādaśākāram)
Roda Dharma berputar, (dharmacakram pravartitam)
Kaundinya telah mengerti, (kaundinyena ca āj˝ātam)
Dan jadi Tiga Permata telah selesai didirikan. (iti ratanā trayah nirvrttāyah)

Buddha, Dharma, dan Sangha: (buddho dharmaśca samghaśca)
Ini adalah Tiga Permata. (ityetadratanatrayam)
Dari satu sama lainnya Syair diberitakan, (parasparām gatah śabdo)
Hingga sampai ke Istana Brahma. (yāvad brahmapurālayam)

"Telah diputar Roda yang murni tanpa noda, (vartitam virajam cakram)
Oleh sang Pelindung dunia dengan sangat baik. (lokanāthena tāyinā)
Telah muncul Tiga permata di dunia, (utpannā ratanā trīni loke)
Yang paling langka. (paramadurlabhā)"

Kaundinya yang pertama, (kaundinyam prathamam)
Tercapai juga oleh Kelima Bhiksu, (krtvā pa˝cakāścaiva bhiksavah)
Serta enam puluh juta dewa (sastīnām devakotīnām)
Mata Dharma mereka termurnikan (dharmacaksurviśodhitam).

Yang lainnya (anye), delapan puluh juta para devata
Yang dari alam bentuk-rupa (rūpadhātu).
Mata mereka termurnikan (tesām viśodhitam caksu)
Saat Pemutaran Roda Dharma (dharmacakrapravartane).

84.000 manusia (caturaśītisahasrāni manusyānām)
Yang telah hadir (samāgatā)
Mata mereka termurnikan (tesām viśodhitam caksu)
Terbebaskan dari semua takdir buruk (muktā sarvebhi durgatī).

Di sepuluh penjuru arah suara yang tidak terbatas dari sang Buddha menyebar dengan sangat cepat. (daśadiśatu ananta buddhasvaro gacchi tasmin kasne)
Suara yang menyenangkan dan indah ini bisa didengar di seluruh antariksa yang megah: (ruta madhura manoj˝a samśrūyante cāntarīkse śubha)
"Diberkahi dengan sepuluh kekuatan, sang Resi Sakya dengan Roda Dharma tertinggi, (esa daśabalena śākyarsinā dharmacakrottamam)
Pergi ke bukit gugurnya para resi di varanasi, memutarnya. Itulah yang terjadi. (rsipatanamupetya vārānasī vartito nānyathā)"

Di sepuluh penjuru, para ratusan Buddha, semua-Nya terdiam pada saat yang sama. (daśa diśita yi keci buddhaśatā sarvi tūsnībhutāh)
Oleh hal ini semua pembantu para Muni bertanya kepada para sang Jina: (tesa muninaye upasthāyakāh sarvi prcchī jinām)
"Pembicaraan Dharma yang disampaikan melalui sepuluh kekuatan dihentikan ketika mendengar suara ini (kimiti daśabalebhi dharmākathā chinna śrutvā rūtam)
Dengan hormat tolong beritahu kami segera, mengapa Anda menjadi diam? (sādhu bhanata śīghra kim kāranam tūsnībhāvena sthitāh)"

Para Buddha berkata (Buddhanam āha): "Di masa lalu selama ratusan kehidupan (purvabhavaśatebhi) Dia dengan kekuatan semangat berusaha mencapai kebangkitan (vīryābalai bodhi samudāniyā),
Dan melakukannya lebih baik daripada banyak ratusan ribu Bodhisattva. (bahava śatasahasra paścānmukhā bodhisattvā krtāh)
Dengan demikian, sang 'Dermawan (hitakara)', mencapai pancaran sinar (uttaptatā prāpta) dan kebangkitan yang menguntungkan (bodhih śivā).
Roda Dharma yang berputar tiga kali itu telah diputar (cakra triparivarta prāvartitā), jadi inilah mengapa Kita diam. (tena tūsnībhutāh)"

Ketika jawaban ini terdengar oleh ratusan juta para makhluk dari para Muni itu, (imu vacana śrunitva tesām munīsattvakotyah śatā)
Dengan mengembangkan kekuatan cinta kasih dan masuk ke dalam kebangkitan tertinggi yang menguntungkan. (maitrabala janitva samprasthitā agrabodhim śivām)
Mereka berkata: "Bahkan kami bisa mengikuti jejak dari Muni ini dengan ketekunan dan kekuatan-Nya yang mulia. (vayamapi anuśiksi tasyā mune vīryasthāmodgatam)
Semoga kami segera menjadi yang terbaik di dunia, memberikan mata Dharma kepada yang lainnya. (ksipra bhavema loki lokottamā dharmacaksurdadāh)"

Lalu pada saat itu sang Bodhisattva Mahasattva, Maitreya menyapa sang Bhagavan (atha khalu maitreyo bodhisattvo mahāsattvo bhagavantametadavocat): "Bhagavan, para Bodhisattva Mahasattva yang tinggal berdiam di sepuluh penjuru dunia (daśadiglokadhātusamnipatitā bodhisattvā mahāsattvā) ingin mendengar dari Bhagavatah secara pribadi untuk mempelajari bagaimana Anda memutar Roda Dharma. Oleh karena itu, Bhagavān, berbaik hatilah untuk menjelaskan apa jenis Roda Dharma, yang telah diputar oleh sang Tathāgato Arhan Samyaksambuddhah. "

Sang Bhagavān berkata: "yang mendalam, Maitreya, adalah Roda Dharma, tidak bisa digenggam oleh kecerdasan (gambhīram maitreya dharmacakram grāhānupalabdhitvāt). Roda ini sulit dilihat, melampaui di luar dualitas (durdarśam taccakram dvayavigatatvāt). Roda ini sulit dipahami, bukanlah objek penyelidikan pikiran dari penyelidikan pikiran (duranubodham taccakram manasikārāmanasikāratvāt). Roda ini sulit disadari, ada berhubungan dengan kesamaan dari pengetahuan dan kebijaksanaan (durvij˝ānam taccakram j˝ānavij˝ānasamatānubaddhatvāt).

"Roda ini tanpa noda, mengarah ke pencapaian pembebasan, yang bebas dari halangan (anāvilam taccakram anāvaranavimoksapratilabdhatvāt). Roda ini halus, tidak dapat dicontohkan (sūksmam taccakram anupamopanyāsavigatatvāt). Roda ini adalah intisari yang penting, mengarahkan ke pencapaian kebijaksanaan yang seperti Vajra (sāram taccakram vajropamaj˝ānapratilabdhatvāt). Roda ini tidak bisa dihancurkan, telah ada sebelum perputarannya (abhedyam taccakram pūrvāntasambhavatvāt).

"Roda ini tiada pelipatgandaan gagasan, tiada sumber pelipatgandaan gagasan (aprapa˝cam taccakram sarvaprapa˝copārambhavigatatvāt). Roda ini tidak terganggu, memiliki kekokohan yang tidak terbatas (akopyam taccakram atyantanisthatvāt). Roda ini mencakup segala sesuatu, sebanding dengan ruang angkasa (sarvatrānugatam taccakram ākāśasadrśatvāt).

"Maitreya, Roda Dharma ini 'memiliki sifat alami intisari dari semua gejala kejadian (sarvadharmaprakrtisvabhāvam)'. Ini adalah Roda dengan kekuatan untuk mengajar (samdarśanavibhavacakram). Ini adalah Roda yang melampaui di luar kelahiran, penghentian, dan keberadaan (anutpādānirodhāsambhavacakram). Ini adalah Roda yang tanpa tempat (anālayacakram). Ini adalah Roda jalan Dharma dari tiada gagasan pembedaan hingga seluruh wilayanya (akalpāvikalpadharmanayavistīranacakram).

"Ini adalah Roda kekosongan (śūnyatācakram), Roda yang tanpa tanda (animittacakram), Roda yang bebas dari niat apapun (apranihitacakram). Ini adalah Roda yang tidak berkondisi (anabhisamskāracakram), Roda kesendirian (vivekacakram), Roda yang tiada kemelekatan (virāgacakram), Roda penghentian (virodhacakram), dan Roda pikiran tercerahkan dari Tathagata (tathāgatānubodhacakram).

"Ini adalah Roda yang tidak terbingungkan oleh alam gejala kejadian (dharmadhātvasambhedacakram), Roda yang tidak terganggu oleh batas asli (bhūtakotyavikopanacakram). Ini adalah Roda tanpa kemelekatan pengaburan (asangānāvaranacakram). Ini adalah Roda yang terbebas dari dua pandangan berlebihan dalam memahami kondisi yang saling ketergantungan (pratītyāvatārobhayāntadrstisamatikramanacakram). Ini adalah Roda yang tanpa gangguan dalam alam gejala kejadian yang melampaui di luar pusat dan tepi (anantamadhyadharmadhātvavikopanacakram).


Terakhir diubah oleh skipper tanggal Sat Feb 13, 2016 8:56 pm, total 6 kali diubah

skipper

Jumlah posting : 439
Join date : 27.11.08
Age : 28

Lihat profil user http://aryamahayana.forumup.com

Kembali Ke Atas Go down

Om Benzra Sato Hum

Post by skipper on Sat Feb 13, 2016 8:58 pm

"Ini adalah Roda kegiatan yang tanpa usaha dan tanpa henti dari Buddha (anābhogabuddhakāryapratipraśrabdhacakram), Roda yang melampaui di luar kegiatan dan yang bukan kegiatan (apravrtyabhinirvrtticakram), Roda yang sepenuhnya tidak bisa terggenggam (atyantānupalabdhicakram), Roda yang melampaui di luar usaha dan yang tanpa usaha (anāyūhāniryūhacakram), Roda yang tidak terungkapkan (anabhilāpyacakram), Roda yang sama seperti sifat alami ucapan (prakrtiyathāvaccakram), Roda yang memasuki kesamaan dari semua gejala kejadian dalam lingkup tunggal (ekavisayasarvadharmasamatāvatāracakram).

"Ini adalah Roda yang tidak pernah memutarbalik dan terus menerus melimpahkan bimbingan dan berkah pada makhluk hidup yang terrampas kebebasan (aksanasattvavinayādhisthānapratyudāvartyacakram), Roda yang memasuki jalan kebenaran hakiki yang menganggap tiada mendua (advayasamāropaparamārthanayapraveśacakram), Roda yang asli sungguh memasukkan alam gejala kejadian (dharmadhātusamavasaranacakram), Roda yang tidak terukur karena melampaui semua batas (apremayam taccakram sarvapramānātikrāntam).

"Roda ini tidak bisa dihitung karena melampaui di luar dari yang dapat dihitung (asamkhyeyam taccakram sarvasamkhyāpagatam). Roda ini tidak terbayangkan karena ini melampaui di luar alam pikiran gagasan (acintyam taccakram cittapathasamatikrāntam). Roda ini tiada bandingannya karena berada di luar kesetaraan (atulyam taccakram tulāpagatam). Roda ini tidak terungkapkan karena di luar semua jalur dari kata yang terdengar (anabhilāpyam taccakram sarvarutaghosavākpathātītam).

"Ini tak terbatas (apramāna), yang tanpa contoh karena di luar contoh (anupamamupamāgata), yang sama seperti ruang angkasa (ākāśasama); Ini tidak berhenti, namun juga bukan permanen. Menerima saling ketergantungan, tidak mengganggu ketentramannya; Ini adalah kedamaian yang tanpa batas. Ini adalah kenyataan itu sendiri. Sifat alaminya tidak lain adalah itu, tidak seperti itu, atau tidak juga begitu.

"Ini berbicara bahasa semua makhluk (sarvasattvarutacaranam). Ini melenyapkan semua kekuatan Mara dan mengalahkan tīrthikā. Ini adalah pelarian dari 'perputaran keberadaan (samsara)'. Ini yang masuk kedalam wilayah para Buddha (buddhavisaye). Ini dipahami oleh 'makhluk mulia (āryapudgala)' dan dicapai oleh pratyekabuddha. Para Bodhisattva memperolehnya (parigrhītam bodhisattvaih). Ini dipuji oleh semua Buddha dan tidak bisa terpisahkan dari semua Tathāgata (stutam sarvabuddhairasambhinnam sarvatathāgataih)."

"Yang seperti itu, Maitreya, adalah Roda Dharma yang diputar oleh para Tathāgata. Itu adalah ketika Roda ini diputar oleh Dia maka Dia disebut sebagai sang Tathāgata, disebut sebagai sang Samyaksambuddha, disebut sebagai sang Svayambhū, disebut sebagai sang Penguasa Dharma (dharmasvāmī), disebut sebagai sang Penguasa yang membimbing (nāyaka), disebut sebagai sang Penguasa Pembimbing yang sempurna (vināyaka), disebut sebagai sang Pembimbing yang lengkap (parināyaka), disebut sebagai sang Pemimpin (sārthavāha), disebut sebagai Yang dengan penguasaan atas semua dharma (sarvadharmavaśavartī), dan disebut sebagai sang Penguasa Dharma (dharmeśvara).

"Dia juga disebut sebagai Yang memutar Roda Dharma (dharmacakrapravartī), disebut sebagai sang Penguasa kekayaan Dharma (dharmadānapati), disebut sebagai sang Penguasa persembahan (yaj˝asvāmī), disebut sebagai Yang memberikan persembahan sempurna (suyastayaj˝a), disebut sebagai Yang menyelesaikan tindakan disiplin (siddhivrata), disebut sebagai Yang menyempurnakan semua tujuan (pūrnābhiprāya), disebut sebagai sang Pengajar (deśika), disebut sebagai sang Penenang yang menghibur (āśvāsaka), disebut sebagai sang Pemberi ketentraman (ksemamkara), disebut sebagai sang Pahlawan (śūra), disebut sebagai Yang meninggalkan penderitaan (ranamjaha).

"Dia juga disebut sebagai sang Pemenang pertempuran (vijitasamgrāma), disebut sebagai Yang menegakkan payung, bendera kemenangan, dan spanduk (ucchritachatradhvajapatāka), disebut sebagai Yang bersinar (ālokakara), disebut sebagai Yang berseri-seri (prabhamkara), disebut sebagai Yang membubarkan kegelapan (tamonuda), disebut sebagai sang Pembawa obor (ulkādhārī), disebut sebagai Raja Penyembuh Besar (mahāvaidyarāja), disebut sebagai sang Penyembuh sempurna (bhūtacikitsaka), dan disebut sebagai sang Penghancur Racun Besar (mahāśalyahartā).

"Dia disebut sebagai Yang melihat kebijaksanaan sangat jelas (vitimiraj˝ānadarśana), disebut sebagai Yang melihat seluruh semesta (samantadarśī), disebut sebagai Yang mengamati seluruh semesta (samantavilokita), disebut sebagai sang Mata semesta (samantacaksu), disebut sebagai Yang menyinari seluruh semesta (samantaprabha), disebut sebagai Yang menerangi seluruh semesta (samantāloka), disebut sebagai Yang menatap seluruh semesta (samantamukha), disebut sebagai sang Matahari semesta (samantaprabhākara), disebut sebagai sang Bulan semesta (samantacandra), disebut sebagai sang Keindahan semesta (samantaprāsādika), disebut sebagai Yang tidak pernah berdiam atau tidak menerima atau menolak (apratisthānāyūhāniryūha).

"Dia disebut sebagai Yang sama seperti Bumi (dharanīsama), karena tidak merasa gembira atau tertekan (anunnatāvanatatvāt). Dia disebut sebagai Yang sama seperti Raja gunung (śailendrasama), karena tidak tergoyahkan (aprakampyatvāt). Dia disebut sebagai Kemuliaan Semua Dunia (sarvalokaśrī) karena memiliki semua kualitas dunia (sarvalokagunasamanvāgatatvāt). Dia disebut sebagai Puncak Yang Tidak Terlihat (anavalokitamūrdha), karena jelas mengungguli seluruh dunia (sarvalokābhyudgatatvāt). Dia disebut sebagai Yang menyerupai seperti lautan (samudrakalpa) karena kedalamannya sulit dipahami (gambhīraduravagāhatvāt).

"Dia disebut sebagai Sumber Permata Dharma (dharmaratnākara) karena telah menyempurnakan semua ajaran berharga yang menyebabkan kebangkitan (sarvabodhipāksikadharmaratnapratipūrnatvāt). Dia disebut sebagai Yang sama seperti angin (vāyusama) karena tidak beristirahat di manapun (aniketatvāt). Dia disebut sebagai Yang memiliki kecerdasan yang tanpa kemelekatan (asangabuddhir) karena pikiran-Nya tidak melekat, tak terkekang, dan telah terbebaskan (asaktābaddhāmuktacittatvāt). Dia disebut sebagai dharma yang tanpa kemunduran (avaivartikadharma) karena kesadaran-Nya yang menembus semua gejala kejadian (sarvadharmanirvedhikaj˝ānatvāt). Dia disebut sebagai Yang sama seperti Api (tejahsama) karena setelah menghentikan semua kepalsuan, Dia membakar habis semua emosi yang mengganggu (durāsadasarvamananāprahīnasarvakleśadāhapratyupasthānatvāt).

"Dia disebut sebagai Yang sama seperti air (apsama) karena telah memurnikan kejahatan, selalu memiliki pikiran yang murni dan tubuh serta pikiran yang tanpa noda (anāvilasamkalpanirmalakāyacittavāhitapāpatvāt). Dia disebut sebagai Yang sama seperti langit (ākāśasama) karena telah mewujudkan kebijaksanaan dari alam gejala kejadian, yang tanpa pusat atau tepi, yang berada di dalam wilayah kebijaksanaan yang tidak melekat(asangaj˝ānavisayānantamadhyedharmadhātugocaraj˝ānābhij˝aprāptatvāt).

"Dia disebut sebagai Yang tinggal di dalam keadaan yang terbebaskan pada kebijaksanaan yang tidak terhalang (anāvaranaj˝ānavimoksavihārī) karena telah meninggalkan semua gejala kejadian yang mengaburkan dan yang berbeda-beda (nānāvaranīyadharmasuprahīnatvāt). Dia disebut sebagai Yang dengan Tubuh yang muncul keluar sepenuhnya dari alam gejala kejadian (sarvadharmadhātuprasrtakāya) karena melampaui jalur dari penglihatan yang sama seperti ruang angkasa (gaganasamacaksuhpathasamatikrāntatvāt). Dia disebut sebagai Makhluk Yang Tertinggi (uttamasattva) karena tidak memiliki emosi yang mengganggu yang disebabkan oleh semua objek duniawi (sarvalokavisayāsamklistatvāt).

"Dia disebut sebagai Makhluk Yang Tanpa Kemelekatan (asangasattva), disebut sebagai Yang berkecerdasan tidak terbatas (apramānabuddhir), disebut sebagai sang Pengajar Dharma yang melampaui dunia (lokottaradharmadeśika), disebut sebagai sang Guru dunia (lokācārya), disebut sebagai sang Penyembuh dunia (lokavaidya), disebut sebagai Yang mengungguli dunia (lokābhyudgata), disebut sebagai Yang tidak ternoda oleh urusan duniawi (lokadharmānupalipta), disebut sebagai sang Pelindung dunia (lokanātha), disebut sebagai Yang tertua di dunia (lokajyestha), disebut sebagai Yang terunggul di dunia (lokaśrestha), disebut sebagai sang Penguasa dunia (lokeśvara), disebut sebagai Yang disembah dunia (lokamahita), disebut sebagai Perlindungan terakhir dunia (lokaparāyana), disebut sebagai Yang meninggalkan dunia (lokapāramgata), disebut sebagai Cahaya dunia (lokapradīpa), dan disebut sebagai Yang melampaui dunia (lokottara).

"Dia disebut sebagai sang Tuan dunia (lokaguru), disebut sebagai Yang menguntungkan dunia (lokārthakara), disebut sebagai Yang melayani dunia (lokānuvartaka), disebut sebagai Yang mengetahui dunia (lokavid), disebut sebagai Yang telah menjadi ādhipati dunia (lokādhipateyaprāpta), disebut sebagai sang Penerima pemberian besar (mahādaksinīya), disebut sebagai Yang layak diberikan persembahan (pūjārha), disebut sebagai Lapangan jasa kebajikan yang besar (mahāpunyaksetra), disebut sebagai sang Makhluk Besar (mahāsattva), disebut sebagai sang Makhluk Tertinggi (agrasattva), disebut sebagai sang Makhluk yang paling unggul (varasattva), disebut sebagai sang Makhluk yang terbaik (pravarasattva), disebut sebagai sang Makhluk yang paling ditinggikan (uttamasattva), disebut sebagai sang Makhluk yang tiada tanding (anuttarasattva), dan disebut sebagai sang Makhluk yang unik (asadrśasattva).

"Dia disebut sebagai Yang selalu berdiam dalam ketenangan hati (satatasamāhita), disebut sebagai Yang berdiam dalam kesamaan semua gejala kejadian (sarvadharmasamatāvihārī), disebut sebagai Yang telah menemukan jalan (mārgaprāpta), disebut sebagai sang Pengajar jalan (mārgadarśaka), disebut sebagai sang Penunjuk jalan (mārgadeśika), dan disebut sebagai Yang sungguh berdiam di jalan (supratisthitamārga).

"Dia disebut sebagai Yang telah melampaui wilayah Mara (māravisayasamatikrānta), disebut sebagai Yang telah menghancurkan rombongan Mara (māramandalavidhvamsakara), disebut sebagai Yang tidak lagi tunduk pada usia tua dan kematian dan yang menemukan kualitas yang menakjubkan. Dia disebut sebagai Yang tanpa kegelapan (vigatatamondhakāra), disebut sebagai Yang tanpa cacat (vigatakantaka), disebut sebagai Yang tanpa hasrat mendamba (vigatakānksa), disebut sebagai Yang tanpa emosi yang mengganggu (vigatakleśa), disebut sebagai Yang telah menghilangkan keraguan (vinītasamśaya), disebut sebagai Yang telah menaklukkan ketidakpastian (vimatisamuddhatita), disebut sebagai Yang tanpa kemelekatan (virakta), disebut sebagai Yang bebas (vimukta), disebut sebagai Yang murni (viśuddha), disebut sebagai Yang tanpa hasrat keinginan (vigatarāga), disebut sebagai Yang tanpa kemarahan (vigatadosa), disebut sebagai Yang tanpa angan-angan khayalan (vigatamoha), disebut sebagai Yang telah melenyapkan kekotoran batin (ksīnāśrava), disebut sebagai Yang tiada emosi yang mengganggu (nihkleśa), disebut sebagai Yang berkuasa (vaśībhūta), dan disebut sebagai Yang pikiran-Nya sepenuhnya bebas (suvimuktacitta).

"Dia disebut sebagai Yang kebijaksanaan-Nya sepenuhnya bebas (suvimuktapraj˝a), disebut sebagai Yang mengetahui (ājāneya), disebut sebagai sang Gajah besar (mahānāga नग), disebut sebagai Yang telah menyelesaikan pekerjaan-Nya (krtakrtya), disebut sebagai Yang telah menyelesaikan apa yang perlu dilakukan (krtakaranīya), disebut sebagai Yang menghilangkan beban (apahrtabhāra), disebut sebagai Yang menunda kepentingan-Nya sendiri (anuprāptasvakārtha), disebut sebagai Yang telah melenyapkan semua belenggu batin hingga keberadaan (pariksīnabhavasamyojana), dan disebut sebagai Yang telah dibebaskan oleh kebijaksanaan dari kesamaan (samatāj˝ānavimukta).

"Dia disebut sebagai Yang telah menyempurnakan semua kekuatan tertinggi dari pikiran (sarvacetovaśiparamapāramitāprāpta), disebut sebagai Yang telah menyempurnakan kemurahan hati (dānapāraga), disebut sebagai Yang paling luhur melalui disiplin (śīlābhyudgata), disebut sebagai Yang telah menyempurnakan kesabaran (ksāntipāraga), disebut sebagai Yang paling luhur melalui semangat ketekunan (vīryābhyudgata), disebut sebagai Yang telah mencapai pengetahuan yang lebih tinggi melalui konsentrasi (dhyānābhij˝aprāpta), disebut sebagai Yang telah menyempurnakan kebijaksanaan pengetahuan (praj˝āpāramgata), dan disebut sebagai Yang telah mencapai cita-cita (siddhapranidhāna).

"Dia disebut disebut sebagai Yang berada di dalam Cinta kebaikan yang besar (mahāmaitravihārī), disebut sebagai Yang tinggal berdiam dalam belas kasihan yang besar (mahākarunāvihārī), disebut sebagai Yang tinggal berdiam dalam sukacita yang besar (mahāmuditāvihārī), dan disebut sebagai Yang tinggal berdiam dalam keseimbangan batin yang besar (mahopeksāvihārī), disebut sebagai Yang rajin mengumpulkan makhluk hidup (sattvasamgrahaprayukta), disebut sebagai Yang telah mencapai kesadaran yang tidak kusam dari segala sesuatu (anāvaranapratisamvitprāpta), disebut sebagai Perlindungan untuk setiap orang (pratiśaranabhūta), disebut sebagai Jasa kebajikan besar (mahāpunya), disebut sebagai Pengetahuan yang besar (mahāj˝ānī), dan disebut sebagai Yang sempurna perhatian kesadaran, cara berpikir, dan kecerdasan (smrtimatigatibuddhisampanna).

"Dia disebut sebagai Yang mencapai cahaya terang karena memiliki cabang-cabang kebangkitan, seperti landasan dari perhatian kesadaran, pelenyapan yang tepat, kekuatan ajaib, indera, kekuatan, serta ketenangan dan wawasan (smrtyupasthānasamyakprahānarddhipādendriyabalabodhyangasamarthavidarśanālokaprāpta).

"Dia disebut sebagai Yang menyeberangi lautan samsara (uttīrnasamsārārnava), disebut sebagai Yang datang ke pantai seberang (pāraga), disebut sebagai Yang telah datang ke tanah kering (sthalagata), disebut sebagai Yang mencapai kedamaian (ksemaprāpta), disebut sebagai Yang mencapai keberanian (abhayaprāpta), dan disebut sebagai Yang tidak terluka oleh duri emosi yang mengganggu (marditakleśakantaka).

"Dia disebut sebagai sang Makhluk (purusa), disebut sebagai sang Makhluk besar (mahāpurusa), disebut sebagai sang Singa diantara makhluk (purusasimha), disebut sebagai Yang tidak tunduk pada ketakutan dan kegembiraan (vigatabhayalomaharsana), disebut sebagai sang Gajah (nāga), disebut sebagai Yang tanpa noda (nirmala), disebut sebagai Yang telah melenyapkan tiga noda (trimalamalaprahīna), disebut sebagai Yang mengumumkan (vedaka), disebut sebagai Yang mencapai tiga jenis wawasan (traividyānuprāpta), disebut sebagai Yang telah menyeberangi empat sungai (caturoghottīrna), disebut sebagai Yang telah mencapai pantai lainnya (pāragata).

"Dia disebut sebagai kaum Kerajaan (ksatriya), disebut sebagai sang Suci (brāhmana), disebut sebagai Satu-satunya yang membawa payung permata (ekaratnachatradhārī), disebut sebagai Yang melenyapkan ajaran sesat (vāhitapāradharma), disebut sebagai sang Bhiksu, disebut sebagai Yang menghancurkan cangkang telur ketidaktahuan (bhinnāvidyāndakośa). disebut sebagai sang Sramana, disebut sebagai Yang sungguh melampaui di luar kemelekatan pada uang dan keuntungan (arthasangapathasamatikrānta), disebut sebagai Yang fasih dengan pengetahuan suci (śrotriya), disebut sebagai Yang kekotoran batin telah pergi (nihsrtakleśa).

"Dia disebut sebagai Yang kuat (balavāni), disebut sebagai sang Pemegang sepuluh kekuatan (daśabaladhārī), disebut sebagai sang Bhagavān, disebut sebagai Yang telah mengembangkan pengekangan fisik (bhāvitakāya), disebut sebagai sang Rajanya para raja (rājātirāja), disebut sebagai sang Raja Dharma (dharmarāja), disebut sebagai Yang memutar dan mengajarkan Roda Dharma yang suci dan tertinggi (varapravaradharmacakrapravartyanuśāsaka), disebut sebagai Yang mengajarkan Dharma yang tanpa perselisihan (akopyadharmadeśaka), dan disebut sebagai Yang memberikan penyucian menjadi kebijaksanaan yang mengetahui semua (sarvaj˝aj˝ānābhisikta).

"Dia disebut sebagai Yang terikat dengan ikat kepala yang tanpa noda dari pembebasan, pengetahuan besar, dan ketidakterikatan (asangamahāj˝ānavimalaviruktapattabaddha), disebut sebagai Yang memiliki permata dari tujuh faktor kebangkitan (saptabodhyangaratnasamanvāgata), disebut sebagai Yang telah mencapai semua kualitas yang khusus dari Dharma (sarvadharmaviśesaprāpta), disebut sebagai Yang wajah-Nya yang bulat ditatap oleh semua menteri dan pendengar yang mulia (sarvāryaśrāvakāmātyāvalokitamukhamandala), disebut sebagai Yang dikelilingi oleh para putra Bodhisattva Mahasattva (bodhisattvamahāsattvaputraparivāra), disebut sebagai Yang sangat lembut melalui disiplin (suvinītavinaya), dan disebut sebagai Yang dapat dengan mudah meramalkan Bodhisattva (suvyākrtabodhisattva).

"Dia disebut sebagai Yang sama seperti Vaisravana (vaiśravanasadrśa), disebut sebagai Yang memberikan sumbangan dari tujuh kekayaan yang mulia (saptāryadhanaviśrānitakośa), disebut sebagai Yang mengabulkan semua harapan (tyaktatyāga), disebut sebagai Yang dalam memiliki semua jenis sempurna dari kebahagiaan (sarvasukhasampattisamanvāgata), disebut sebagai Yang semua tujuan-nya termurnikan (sarvābhiprāyadāte), dan disebut sebagai Yang menopang seluruh dunia dengan bantuan dan kebahagiaan (sarvalokahitasukhānupālaka).

"Dia disebut sebagai Yang sama seperti Indra (indrasama), disebut sebagai sang Pemegang Vajra dari kekuatan kebijaksanaan (j˝ānabalavajradhārī), disebut sebagai sang Mata semesta (samantanetra), disebut sebagai Yang ámelihat semua gejala kejadian dengan pengetahuan yang tidak terkaburkan (sarvadharmānāvaranaj˝ānadarśī), disebut sebagai Yang perubahan wujud melalui pengetahuan semesta (samantaj˝ānavikurvana), dan disebut sebagai Yang menampilkan tarian yang luas dari Dharma (vipuladharmanātakadarśanapravista).

"Dia disebut sebagai Yang sama seperti Bulan (candrasama), disebut sebagai Yang semua makhluk tidak pernah bosan memandang (sarvajagadatrptadarśana), disebut sebagai sang Cahaya terang yang menjangkau luas seluruh semesta (samantavipulaviśuddhaprabha), disebut sebagai sang Cahaya yang memberikan sifat yang ramah dan kesenangan besar (prītiprāmodyakaraprabha), disebut sebagai sang Cahaya yang melihat muka semua makhluk (sarvasattvābhimukhadarśanābhāsa), disebut sebagai Yang bersinar di benak dan pikiran dari semua makhluk sehingga muncul persis seperti ada adanya (sarvajagaccittāśayabhājanapratibhāsaprāpta), disebut sebagai sang Perwujudan besar (mahāvyūha), dan disebut sebagai Yang dikelilingi oleh bintang-bintang dari orang-orang yang sedang belajar dan mereka yang tidak belajar lagi (śaiksāśaiksajyotirganaparivāra).

"Dia disebut sebagai Yang sama seperti Lingkaran Matahari (ādityamandalasama), disebut sebagai Yang melenyapkan kegelapan dari angan-angan khayalan (vidhūtamohāndhakāra), disebut sebagai sang Raja Spanduk Besar (mahāketurāja), disebut sebagai sang Cahaya yang tidak terbatas dan tidak terukur (apramānānantaraśmi), disebut sebagai Yang menerangi semua dengan cahaya besar (mahāvabhāsasamdarśaka), disebut sebagai Yang tidak pernah bingung menjelaskan pertanyaan dan memberikan ramalan (sarvapraśnavyākarananirdeśāsammūdha), disebut sebagai Yang telah menaklukkan kegelapan besar ketidaktahuan (mahāvidyāndhakāravidhvamsanakara), disebut sebagai Yang tanpa gagasan yang membeda-bedakan, merasakan segala sesuatu dengan cahaya kebijaksanaan yang besar (mahāj˝ānālokavilokitabuddhinirvikalpa), disebut sebagai Yang memancarkan sinar cahaya yang ásama rata untuk semua makhluk hidup dengan cara yang tidak terbatas melalui cinta kasih-Nya, kebaikan hati-Nya, dan belas kasihan-Nya yang besar (mahāmaitrīkrpākarunāsarvajagatsamaraśmipramuktapramānavisaya), disebut sebagai Yang memiliki Mandala dari kesempurnaan yang mendalam dari kebijaksanaan yang sulit untuk didapatkan dan sulit untuk dilihat (praj˝āpāramitāgambhīradurāsadadurnirīksamandala).

"Dia disebut sebagai Yang sama seperti Brahma (brahmasama), disebut sebagai sang Jalan Arya yang sangat tenang (praśānteryāpatha), disebut sebagai Yang memiliki semua kualitas khusus dari perilaku di Jalan Arya (sarveryāpathacaryāviśesasamanvāgata), disebut sebagai Yang memiliki bentuk-rupa tertinggi (paramarūpadhārī), disebut sebagai Yang indah untuk dilihat (asecanakadarśana), disebut sebagai sang Indera yang tenang (śāntendriya), disebut sebagai sang Pikiran yang damai (śāntamānasa), disebut sebagai Yang telah menyempurnakan keheningan yang tenang (śamathasambhāraparipūrna), disebut sebagai Yang telah mencapai keheningan tenang yang utama (uttamaśamathaprāpta), disebut sebagai Yang telah mencapai pengendalian diri tertinggi dan keheningan yang tenang (paramadamaśamathaprāpta), disebut sebagai Yang telah menyempurnakan keheningan yang tenang dan wawasan pengetahuan (śamathavidarśanāparipūrnasambhāra).

"Disebut sebagai Yang tersembunyi (gupto) dan indera yang tenang yang sama seperti gajah yang terjinakkan dengan baik (jitendriyo nāga iva sudānto), danau (hrada) yang murni tanpa noda dan tenang (ivāccho'nāvilo viprasanna). disebut sebagai Yang telah sepenuhnya meninggalkan semua halangan dari kecenderungan kebiasaan dan emosi yang mengganggu (sarvakleśavāsanāvaranasuprahīna), disebut sebagai Yang memiliki tiga puluh dua tanda dari Makhluk Besar (dvātrimśanmahāpurusalaksanasamanvāgata), disebut sebagai Makhluk tertinggi (paramapurusa), disebut sebagai Yang Tubuh-Nya indah dihiasi dengan delapan puluh tanda-tanda yang sangat baik (aśītyanuvya˝janaparivāravicitraracitagātra), disebut sebagai Yang paling utama di antara makhluk (purusarsabha), disebut sebagai Yang memiliki sepuluh kekuatan (daśabalasamanvāgata), disebut sebagai sang Kusir dari mereka yang untuk dibimbing oleh Makhluk tanpa tandingan yang memiliki empat jenis kepercayaan Diri (caturvaiśāradyaprāptānuttarapurusadamyasārathi), disebut sebagai sang guru (śāsta), disebut sebagai Yang telah menyempurnakan delapan belas kualitas yang unik dari Buddha (astādaśāvenikabuddhadharmaparipūrna).

"Disebut sebagai Yang tubuh, ucapan, dan kegiatan pikiran melampaui di luar kesalahan (aninditakāyavānmanaskarmānta),
disebut sebagai Yang dengan semua aspek tertinggi yang telah memurnikan permukaan cermin pengetahuan (sarvākāravaropetasupariśodhitaj˝ānadarśanamandala),
disebut sebagai Yang tinggal berdiam dalam kekosongan (shūnyatāvihārī) karena telah menyadari kesamaan dalam kaitannya dengan yang bergantungan (pratītyasamutpādasamatā),
disebut sebagai Yang tinggal berdiam di dalam ketiadaan sebab-musabab dan di dalam pengetahuan sempurna yang tercerahkan dengan lengkap (pratītyasamutpādasamatābhisambodhādānimittavihārī), karena telah menyadari cara kebenaran tertinggi (paramārthasatyanaya),
disebut sebagai Yang tinggal berdiam di dalam ketiadaan nafsu keinginan (prativedhādapranihitavihārī), karena tidak ternoda oleh semua kegiatan (sarvaprasthānālipta),
disebut sebagai Yang tidak berada dalam wilayah pembentukan (anabhisamskāragocara), karena telah melenyapkan semua pembentukan (sarvasamskārapratipraśrabdha),
disebut sebagai Yang berbicara kebenaran (bhūtavādī), karena lingkup pengetahuan-Nya tidak terganggu mengenai batas asli (bhūtakotyavikopitaj˝ānavisayatvādavitathān),
disebut sebagai Yang berbicara tanpa kesalahan (anyathāvādī), karena menyadari kenyataan yang apa adanya, alam gejala kejadian, seperti ruang angkasa, tiada memiliki tanda maupun tiada tanpa tanda (tathatādharmadhātvākāśalaksanālaksanavisaya),
disebut sebagai Yang mencapai Dharma yang tanpa emosi yang mengganggu (adaranyadharmasupratilabdha), karena memahami bahwa semua gajala kejadian adalah sama seperti ilusi, fatamorgana, mimpi, pantulan bulan di air, gema, dan halusinasi (māyāmarīcisvapnodakacandrapratiśrutkapratibhāsasamatāsarvadharmavihāri),
disebut sebagai Yang tanpa kesalahan dalam memperlihatkan dan memperdengarkan (amoghadarśanaśravana), karena menghasilkan penyebab pemadaman yang seluruhnya (parinirvānahetujanaka),
disebut sebagai Yang berjalan dengan langkah yang tanpa kesalahan (amoghapadavikramī), karena memiliki kekuatan semangat yang kuat untuk membimbing makhluk hidup (sattvavinayaparākramavikrānta),
disebut sebagai Yang terbebas dari keletihan (utksiptaparikheda), karena telah memusnahkan ketidaktahuan dan hasrat keinginan pada keberadaan (avidyābhavatrsnāsamucchinna),
disebut sebagai Yang telah membangun jembatan (sthāpitasamkrama), karena dengan benar mengajarkan jalan yang membebaskan (nairyānikapratipatsudeśaka),
disebut sebagai Yang telah mengalahkan iblis mara, emosi yang mengganggu, dan para musuh (nirjitamārakleśapratyarthika), karena tidak terkotori oleh semua kegiatan dan wilayah iblis mara (sarvamāravisayacaryānanulipta),
disebut sebagai Yang telah lolos menyeberangi rawa lumpur nafsu keinginan (uttīrnakāmapanka), karena telah benar-benar melampaui alam nafsu keinginan (kāmadhātusamatikrānta),
disebut sebagai Yang telah menurunkan bendera kebanggaan (pātitamānadhvaja), karena telah benar-benar melampaui alam bentuk-rupa (rūpadhātusamatikrānta),
disebut sebagai Yang telah menaikkan bendera kebijaksanaan (ucchritapraj˝ādhvaja), karena telah benar-benar melampaui alam tanpa bentuk-rupa (ārupyadhātusamatikrānta),
disebut sebagai Yang telah melampaui semua wilayah duniawi (sarvalokavisayasamatikrānta), karena diberkahi dengan tubuh Dharma dan tubuh kebijaksanaan (dharmakāyaj˝ānaśarīra),
disebut sebagai sang Pohon Besar (mahādruma), karena mekar dengan pengetahuan berharga dengan kualitas yang tidak terbatas dan diberkahi dengan buah pembebasan (anantagunaratnaj˝ānasamkusumitavimuktiphalasusampanna),
disebut sebagai Yang seperti Bunga Udumbara (udumbarapuspasadrśa), karena sangat langka kemunculannya dan jarang terlihat (durlabhaprādurbhāvadarśana),
disebut sebagai Yang seperti Raja Permata, sang Permata pengabul keinginan (cintāmaniratnamanirājasama), karena sungguh telah mendirikan tujuan-Nya pada jalan ke nirwana (yathānayanirvānabhiprāyasupratipūrana),
disebut sebagai Yang memiliki telapak kaki rata yang teguh (supratisthitapāda), karena dalam waktu yang sangat lama, telah berlatih, disiplin, kesulitan, dan praktek kehidupan suci secara tegas dan murni dengan tanpa bimbang atau tanpa lelah (dīrgharātram tyāgaśīlatapovratabrahmacaryadrdhasamādānācalāprakampya),
disebut sebagai Yang telapak kaki-Nya ada swastika yang indah, simbol keberuntungan dan roda seribu ruji (vicitrasvastikanandyāvartasahasrācakrānkitapādatala), karena dalam waktu yang sangat lama, para ibu, ayah, śramana, brāhmana, guru, orang yang patut dimuliakan dan pelaku Dharma telah dijaga-Nya dan diberikan perlindungan, tidak pernah ditinggalkan (dīrgharātram mātāpitrśramanabrāhmanagurudaksinīyadhārmikaraksāparipālanatayā śaranāgatānām cāparityāga),
disebut sebagai Yang memiliki tumit yang luas (āyatapārsnir), karena dalam waktu yang sangat lama, telah meninggalkan pembunuhan (dīrgharātram prānātipātoparata),
disebut sebagai Yang memiliki jari yang panjang (dīrghāngulī), karena dalam waktu yang sangat lama, telah membuat orang lain untuk meninggalkan pembunuhan makhluk hidup (dīrgharātram prānātipātavairamanyamparasattvasamādāyana),
disebut sebagai sang Pelindung banyak orang (bahujanatrāte), karena dalam waktu yang sangat lama, telah menjelaskan manfaat kebajikan dari berhenti membunuh (dīrgharātram prānātipātavairamanyamgunavarnasamprakāśana)
disebut sebagai Yang memiliki tangan dan kaki yang halus dan yang lembut (tvānmrdutarunahastapāda), karena dalam waktu yang sangat lama, telah mengerahkan diri dalam mempersiapkan tangan-Nya sendiri dan tubuh-Nya sendiri dengan menggosokkannya dengan mentega susu dan minyak wijen, dan kemudian menggunakan tangan-Nya untuk memandikan dan mengurapi tubuh para ibu, ayah, śramana, brāhmana, guru, orang yang patut dimuliakan sebagai bagian dari layanan pembaktian-Nya kepada mereka (dīrgharātram mātāpitrśramanabrāhmanagurudaksinīyopasthānaparicaryāsnānānulepanasarpitailābhyangasvahastaśarīra-parikarmaparikheda),
disebut sebagai Yang memiliki jari tangan dan jari kaki yang berselaput (jālāngulīhastapāda), karena dalam waktu yang sangat lama, dengan jaring dari empat cara bijaksana untuk menarik murid - kedermawanan, bicara yang menyenangkan, tindakan yang berarti, dan mempraktekkan apa yang diajarkan - telah secara terampil melatih para makhluk yang sangat banyak (dīrgharātram dānapriyavadyatārthakriyāsamānārthatāsamgrahavastujālena sattvasamgrahakauśalyamsuśiksita),
disebut sebagai Yang memiliki kaki melengkung/punggung kaki yang tinggi (ucchangapāda), karena dalam waktu yang sangat lama, telah memperoleh peningkatan akar kebajikan yang unggul (dīrgharātramuttarottari viśistatarakuśalamūlādhyālambana),
disebut sebagai Yang memiliki rambut kepala yang melingkar ke kanan (ūrdhvāngadaksināvartaromakūpa), karena dalam waktu yang sangat lama, telah berputar mengelilingi para ibu, ayah, śramana, brāhmana, guru, orang yang patut dimuliakan, dan caitya dari para tathāgata, dengan hormat mendengarkan Dharma, melukis gambar, membuat rambutnya berdiri di ujung, dan menyebabkan kegembiraan yang sama kepada orang lain dengan mengajarkan Dharma (dīrgharātram mātāpitrśramanabrāhmanagurudaksinīyatathāgatacaityapradaksinīkaranadharmaśravanacitrīkāraromaharsanaparasattvasamharsanadharmadeśanāprayoga),
disebut sebagai Yang memiliki betis seperti yang pada kijang (eneyajangha), karena dalam waktu yang sangat lama, dengan keahlian, telah menghormati dan mendengarkan Dharma, memahaminya, menghafalnya, membacanya, menyebabkan orang lain untuk memahaminya, memastikan makna dan kata-katanya, dan dengan pikiran kerendahan hati menawarkan perlindungan kepada makhluk yang dihadapkan dengan usia tua, sakit, dan kematian, dan dengan hormat menjelaskan Dharma kepada mereka (dīrgharātram satkrtya dharmaśravanagrahanadhāranavācanavij˝āpanārthapadaniścayanistīranakauśalyena jarāvyādhimaranābhimukhānām ca sattvānām śaranagamanānupradānasatkrtyadharmadeśanāparibhavabuddhi),
disebut sebagai Yang memiliki bagian kelamin yang berselubung dengan baik (kośopagatabastiguhya), karena dalam waktu yang sangat lama, secara kukuh menerapkan diri-Nya untuk memuji kehidupan suci dari para śramana, brāhmanā, dan memberi mereka semua perbekalan, telah memberikan pakaian kepada yang tidak memiliki pakaian dan tidak pernah mendekati wanita milik orang lain, telah menjelaskan kebajikan dari kehidupan suci dan menjaga martabat diri-Nya (dīrgharātram śramanabrāhmanānām tadanyesām ca brahmacārinām brahmacaryānugrahasarvapariskārānupradānanagnabalānupradānaparadārāgamanabrahmacaryagunavarna-samprakāśanahryapatrāpyānupālanadrdhasamādāna),
disebut sebagai Yang memiliki lengan yang panjang (pralambabāhuri), karena dalam waktu yang sangat lama, telah memiliki tindakan yang penuh cinta kasih dari tubuh, ucapan, dan pikiran-Nya yang diarahkan untuk tidak merugikan makhluk hidup, dengan cara menjaga lengan dan kaki-Nya (dīrgharātram hastasamyatapādasamyatasattvāvihethanaprayogamaitrakāyakarmavākkarmamanaskarmasamanvāgata),

disebut sebagai Yang memiliki bagian lingkaran yang sempurna seperti pohon Nyagrodha (nyagrodhaparimandala), karena dalam waktu yang sangat lama, telah mengetahui ukuran yang tepat untuk makan dan hanya makan sedikit dengan cara yang terbatas, telah memberikan obat untuk mereka yang lemah oleh kerja keras dari pengendalian diri, tidak pernah membenci orang miskin atau yang hina, tidak pernah menindas mereka yang tanpa pelindung, memperbaiki Caitya para Tathāgata yang rusak, membangun 'Caitya (stupa Buddha)', dan menghapus ketakutan dari mereka yang terganggu oleh kecemasan (dīrgharātram bhojanamātrām j˝ātā alpāhāratodārasamyamaglānabhaisajyānupradānahīnajanāparibhavānāthānavamardanatathāgatacaityaviśīrnapratisamskāranastūpapratisthāpanatvādbhayārditebhyaśca sattvebhyo'bhayapradāna),

disebut sebagai Yang memiliki kulit yang halus dan indah (mrdutarunasūksmacchavi), karena dalam waktu yang sangat lama, telah melayani para ibu, ayah, śramana, brāhmana, guru, orang yang patut dimuliakan dengan memandikan mereka, mengurapi mereka, dan memijat mereka dengan minyak. Ketika dingin Dia menggunakan air panas di bawah sinar matahari, dan ketika panas Dia menggunakan air dingin di tempat teduh, memberikan mereka kenyamanan tergantung pada musim tahunan, telah memberikan mereka tempat tidur dan kursi yang ditutupi dengan kain yang lembut dan menyenangkan, dan kepada Caitya para Tathāgata Dia telah mempersembahkan minyak wangi, spanduk kain halus, bendera, dan benang sutra (dīrgharātram mātāpitrśramanabrāhmanagurudaksinīyānām snānānulepanasarpistailābhyangaśīte usnodakamusne śītodakacchāyātapartusukhaparibhogānupradānamrdutarunatūlasamsparśasukumāravastrāstīrnaśayanāsanānupradānatathāgatacaityagandhatailasekasūksmapattadhvajapatākāgunapradāna),

disebut sebagai Yang memiliki kulit seperti emas (suvarnacchavi), karena dalam waktu yang sangat lama, tidak pernah menolak semua makhluk hidup, dan bahkan telah dengan senang mempraktekkan cinta kasih dan kesabaran sementara membangkitkan orang lain untuk melakukan hal yang sama melalui memuji kualitas yang baik dari pengampunan dan mengharapkan kebaikan untuk yang lainnya, kepada Caitya para Tathāgata dan patung para Tathāgata Dia telah mempersembahkan perhiasan emas, bunga emas, debu emas, dan spanduk sutra yang berwarna emas, juga telah mempersembahkan banyak perhiasan, bejana emas, dan pakaian berwarna emas (dīrgharātram sarvasattvāpratighātamaitrībhāvanāyogaksāntisauratyeparasattvasamādāpanāvairavyāpādagunavarnasamprakāśanatayā tathāgatacaityatathāgatapratimānām ca suvarnakhacanasuvarnapuspasuvarnacūrnābhikiranasuvarnavarnapattapatākādhvajālamkārasuvarnabhājanasuvarnavastrānupradāna)

disebut sebagai Yang memiliki setiap helai rambut yang tidak kusut (ekaikanicitaromakūpa), karena dalam waktu yang sangat lama, telah mengikuti Pandita dan jelas pada apa yang kebajikan dan apa yang bukan, telah bertanya tentang apa yang pantas dan apa yang tidak, apa yang harus dilakukan dan apa yang tidak, dharma mana yang adalah buruk, mana yang biasa saja, dan mana yang luhur, telah memeriksa makna, menilai, dan memperoleh kepastian penuh, telah membersihkan dari serangga, jaring laba-laba, bunga yang layu, berbagai jenis gulma, dan pasir dari Caitya para Tathāgata (dīrgharātram panditopasamkramanakimkuśalākuśalapariprcchanasāvadyānavadyasevyahīnamadhyapranītadharmapariprcchanārthamīmāmsanaparitulanāsammohatathāgatacaityakītalūtālayā˝jaliyānirmālyanānātrnaśarkarāsamuddharanasamprayoga),

disebut sebagai Yang memiliki tujuh tonjolan (saptotsada), karena dalam waktu yang sangat lama, telah menunjukkan rasa hormat kepada para ibu, ayah, pemimpin, tetua, śramana, brāhmana, pengemis, makhluk yang kekurangan, dan banyak orang lain yang telah datang kepada-Nya, memuaskan keinginan mereka dengan menyediakan mereka makanan, minuman, selimut, obat-obatan, pakaian, rumah, lampu, dan semua kebutuhan yang dihasilkan oleh hidup, ditambah sumur dan kolam bunga teratai yang penuh dengan air dingin (dīrgharātram mātāpitrjyesthaśresthapūjyaśramanabrāhmanakrpanavanīpakādibhya upāgatebhyah satkrtya yathābhiprāyamannapānāsanavastrāpaśrayapradīpakalpitajīvikapariskārasampradānakūpapuskarinīśītajalaparīpūrnamahājanopabhogānupradāna),

disebut sebagai Yang memiliki batang tubuh seperti singa (simhapūrvārdhakāya), karena dalam waktu yang sangat lama, telah menunjukkan rasa hormat kepada para ibu, ayah, śramana, brāhmana, guru, orang yang patut dimuliakan, menyapa mereka dengan sedang membungkuk atau bersujud, dan melindungi mereka dari bahaya, tidak pernah menunjukkan rasa tidak hormat kepada yang lemah dan tidak pernah meninggalkan mereka yang mencari perlindungan, tidak pernah meninggalkan tekad-Nya yang kuat (dīrgharātram mātāpitrśramanabrāhmanagurudaksinīyāvanamanapranamanābhivādanābhayapradānadurbalāparibhavaśaranāgatāparityāgadrdhasargadānānutsarga),

disebut sebagai Yang memiliki dada yang luas (citāntarāmsa), karena dalam waktu yang sangat lama, telah mengakui kesalahan sendiri dan tidak pernah menunjukkan kesalahan orang lain yang telah tersandung, telah melepaskan penyebab perdebatan dan tidak terlibat dalam memberitahukan rahasia yang menyebabkan perselisihan di antara orang lain. Dengan cara ini Dia telah menjaga ketat ucapan, tindakan, dan pikiran-Nya (dīrgharātram svadosaparitulanapraskhalitaparachidrādosadarśanavivādamūlaparabhedakaramantraparivarjanasupratinissarga-mantrasvāraksitavākkarmānta),

disebut sebagai Yang memiliki bahu yang bundar dan halus (susamvrttaskandha), karena dalam waktu yang sangat lama, telah menunjukkan rasa hormat kepada para ibu, ayah, śramana, brāhmana, guru, orang yang patut dimuliakan dengan bangun untuk mereka, menyambut mereka, dan menyapa mereka dengan jujur. Karena Dia adalah yang ahli dalam seluruh sastra penjelasan, telah mampu menahan para makhluk yang bernafsu keinginan untuk berdebat dan bahkan telah memajukan Dharma Vinaya-Nya sendiri dengan cara yang bijaksana, telah mendirikan orang lain, seperti para raja dan menteri yang berniat baik, di jalan Dharma, yang telah sepatutnya melanjutkan penyebab kebajikan. Dengan cara ini Dia telah menegakkan keseluruhan ajaran dari para Tathāgata secara sempurna dan membangkitkan orang lain untuk mempraktekkan semua kebajikan (dīrgharātram mātāpitrśramanabrāhmanagurudaksinīyānām pratyutthānapratyudramanābhivādanakāmānām ca sarvaśāstravaiśāradyena vivādakāmasattvanigrahasvadharmavinayānulomanasamyakpravrttarājāmātyasamyakpravrttakuśaladharmapathapratisthāpanaprabhāvanatathāgataśāsanaparigrahasamdhāranasarvakuśalacaryāsamādāpana pūrvamgama),

disebut sebagai Yang memiliki rahang singa (simhahanu), karena dalam waktu yang sangat lama, telah memberikan semua harta kepemilikan dan menyapa para pengemis dengan nama menyenangkan, yang mana pun yang ámereka mungkin suka mendengar. Kapanpun mereka telah datang mendekat, Dia tidak pernah merasa jijik pada mereka, atau mengecewakan mereka, atau membuat mereka pergi. Dengan sepatutnya memenuhi keinginan mereka, Dia tidak pernah goyah dalam tekad-Nya yang kuat untuk menyerahkan kekayaan-Nya (dīrgharātram sarvavastuparityāgayathābhiprāyayācanakapriyābhidhānamupasamkrāntānām cāvimānanājihmīkaranāviksepam sarvesām yathābhiprāyaparipūranadānaparityāgadrdhasamādānānutsarga),

disebut sebagai Yang memiliki empat puluh gigi (catvārimśatsamadanta), karena dalam waktu yang sangat lama, telah benar-benar menghentikan pembicaraan yang memecah belah dan tidak menerima saran yang dapat mengakibatkan perselisihan, bersinar dengan keserasian yang lengkap dari kerukunan, mencela pembicaraan yang memecah belah dan memuji kualitas dari bergaul dalam keserasian yang lengkap (dīrgharātram piśunavacanaparivarjanabhedamantrāgrahanasamdhisāmagrīrocanasamagrānām cedācittena piśunavacanavigarhanasamdhisāmagrīgunavarnaprakāśanaprayoga),

disebut sebagai Yang memiliki gigi putih yang murni (suśukladanta), karena dalam waktu yang sangat lama, telah menghentikan cara-cara jahat dan memakai kebajikan dari kebaikan, telah menghindari perbuatan buruk dan pematangannya, dan memuji tindakan yang baik dan pematangannya. Dia telah membuat persembahan kain putih dan makanan yang dicampur dengan susu, dan telah melukis Caitya dari para Tathāgata dengan kapur dicampur dengan susu, sementara mempersembahkan dengan berbagai jenis bunga putih dan karangan bunga dari sumana, vārsikī, dan bunga dhānuskari (dīrgharātram krsnapaksaparivarjanaśuklapaksakuśalopacayakrsnakarmakrsnavipākaparivarjanaśuklakarmaśuklavipāka-
samvarnanaksīrabhojanaśuklavastrapradānatathāgatacaityesu sudhākrtakaksīramiśrasampradānasumanāvārsikīdhānuskārimālāgunapuspadāmaśuklavarnakusumānupradāna),

disebut sebagai Yang memiliki Gigi yang tanpa celah (aviraladanta), karena dalam waktu yang sangat lama, telah menghentikan tertawa dan mengejek orang lain. Sebaliknya Dia telah membuat semua orang bahagia, menjaga kata-kata, dan mengucapkan dengan cara yang telah membuat orang lain bahagia, tidak pernah mencari kekurangan dan kesalahan pada orang lain, telah berusaha untuk membuat semua orang bergaul dengan baik, tidak pernah goyah dalam tekad-Nya yang kuat untuk mengajarkan Dharma yang sama untuk semua orang (dīrgharātram hāsyoccatyanavivarjanānandakaranavāganuraksanānandakaranavāgudīranaparaskhalitāpara-
chidrāparimārganasarvasattvasamacittasamādāpanasamaprayogasamadharmadeśanadrdhasamādānāparityāga),

disebut sebagai Yang memiliki obatnya obat semesta (rasarasāgravāni रस = obat), karena dalam waktu yang sangat lama, tidak pernah menyakiti atau melukai siapa pun. Sebaliknya Dia telah merawat mereka yang terserang penyakit dan memberikan obat untuk orang sakit, tidak pernah lelah memberikan segala macam ramuan obat kepada mereka yang membutuhkannya (dīrgharātram sarvasattvāvihethanāvihimsanavividhavyādhisprstopasthānaglānabhaisajyānupradānatvātsarvarasārthikebhyaśca sarvarasapradānāparikheda),

disebut sebagai Yang memiliki suara Brahma (bahmasvara), karena dalam waktu yang sangat lama, tidak pernah berbohong atau berbicara kata-kata kasar, juga tidak kasar atau berbohong, atau berusaha untuk menghina orang lain, juga tidak menjadi tidak menyenangkan, atau menyerang kelemahan orang lain. Sebaliknya Dia telah mempraktekkan cinta kasih dan belas kasihan dan menerapkan diri-Nya untuk membuat orang lain merasa bahagia dan puas. Dengan kegembiraan yang bersimpati, Dia telah berbicara kata-kata yang menyebabkan kebahagiaan - menyukai, menyenangkan, dan kata-kata lembut yang telah menyentuh orang lain, memuaskan mereka, dan menyegarkan indera mereka. Dengan cara ini Dia telah menerapkan diri-Nya untuk bicara yang tepat (dīrgharātramanrtaparusakarkaśaśāthyaparakatukaparābhisanginyapriyaparamarbhaghattanavākparivarjana-
maitrīkarunāprayogamuditāprāmodyakaranīsnigdhamamadhuraślaksnahrdayamgamasarvendriyaprahlādakaranīsamyagvākyasamyakprayoga),

disebut sebagai Yang memiliki mata berwarna biru gelap (abhinīlanetra), karena dalam waktu yang sangat lama, telah menganggap para makhluk hidup, dengan penglihatan-Nya yang tanpa hambatan, sebagai Ibu, Ayah, dan Anak-anak-Nya, melihat para pengemis seolah-olah mereka tidak lain adalah anak-anak-Nya, telah dipenuhi dengan cinta kasih dan belas kasihan dan tidak pernah mengecewakan mereka. Dengan indera-Nya, telah memandang Caitya dari para Tathāgata dengan mata tidak berkedip, telah membuat tekad yang kuat untuk membangkitkan para makhluk lain untuk bertemu sang Tathāgata (dīrgharātram mātāpitrvatsarvasattvāpratihatacaksuprayogaikaputravadyācanakamaitrīkārunyapūrvamgamasampreksanājihmī-karanaprasannendriyatathāgatacaityānimisanayanasampreksanaparasattvatathāgatadarśanasamādāpanadrdha-samādāna),

disebut sebagai Yang memiliki bulu mata seperti dari sapi (gopeksanetra), karena dalam waktu yang sangat lama, telah menghentikan sikap yang tidak cerdas dan rendah dan sebaliknya telah menerapkan diri-Nya secara sempurna pada tinggi dan luas, telah membangkitkan para makhluk dengan perasaan gembira untuk Dharma, tidak pernah berwajah bengis kepada orang lain tapi selalu menunjukkan wajah yang tersenyum, telah meminta kehadiran semua kalyānamitra dan dengan kecenderungan, telah mengubah diri-Nya menjadi kumpulan dari semua yang menguntungkan (dīrgharātram hīnacetovivarjanodāravipulādhimuktiparipūranānuttaradharmachandasattvasamādāpanabhrkutīmukha-
vivarjanasmitamukhasarvakalyānamitropasamkramanābhimukhapūrvamgamasarvakuśalopacayāvaivartika),

disebut sebagai Yang memiliki lidah yang panjang (prabhūtajihva), karena dalam waktu yang sangat lama, telah menghentikan semua kesalahan ucapan. Sebaliknya Dia telah menguraikan panjang lebar tentang kebajikan dari para Srāvaka, Pratyekabuddha, dan semua yang mengajarkan Dharma, telah menyalin Sutra dari para Tathāgata, membacanya, melafalkannya, dan menjelaskan kepada orang lain. Mengenai ajaran yang terkandung di dalamnya, Dia telah mampu untuk membedakan antara kata-kata dan makna, dan telah terampil dalam membuat orang lain mengerti yang sama (dīrgharātram sarvavāgdosavivarjanasarvaśrāvakapratyekabuddha-
dharmabhānakāpramānagunavarnasamprakāśanatathāgatasūtrāntalikhanavācanapathanavij˝āpanam tesām ca dharmānāmarthapadaprabhedaparasattvasamprāpanakauśalya),

disebut sebagai Yang memiliki tonjolan mahkota yang tidak terlihat (usnīsānavalokitamūrdha), karena dalam waktu yang sangat lama, telah menghormati para ibu, ayah, śramana, brāhmana, guru, orang yang patut dimuliakan dengan meletakkan kepala-Nya ke kaki mereka, telah memuji para Pravrajita dan menyapa mereka dengan hormat, mencukur rambut mereka, dan mengurapi kepala mereka dengan minyak wangi, telah mempersembahkan bubuk berwarna, tasbih dan karangan bunga, dan perhiasan kepala. (dīrgharātram mātāpitrśramanabrāhmanagurudaksinīyānām mūrdhnām caranatalapranipatanapravrajitavandanābhivādanakeśāvaropanasugandhatailamūrdhniparisi˝canam sarvayācanakebhyaścūrnamālyamālāgunamūrdhābharanānupradāna),

disebut sebagai Yang memiliki bulu Urna di antara alis mata yang bersinar, berwarna sempurna, yang melingkar ke kanan, yang indah (bhrūmadhye sujātapradaksināvartottaptaviśuddhavarnābhāsorna), karena dalam waktu yang sangat lama, telah mendorong orang lain untuk melakukan persembahan yang murah hati dari semua jenis dan menasihati mereka untuk mengikuti ajaran dari semua teman yang berkebajikan, yang dipercayakan oleh Mereka yang mengajarkan Dharma, yang telah pergi ke segala arah tanpa merasa lelah untuk melayani semua Buddha, Bodhisattva, Prattyekabuddhā, Pendengar yang mulia, Pengajar Dharma, ibu dan ayah, guru, dan orang yang patut dimuliakan. Telah mempersembahkan kepada mereka lampu dengan minyak wangi dari berbagai jenis, dan cahaya lampu yang dibuat dengan minyak, mentega, atau rumput, yang menghalau kegelapan, telah memperindah patung para Tathāgata dengan yang paling indah dari hal-hal yang menyenangkan, dan menghiasinya dengan tumpukan permata berwarna putih susu. Karena telah membuat orang lain mengembangkan pikiran kebangkitan, kumpulan kebajikan-Nya telah luar biasa (dīrgharātram nirargalasarvayaj˝ayajanasamādapanasarvakalyānamitrānuśāsanyanuddharadharmabhānakānām dautyapreksane diggamanāgamanāparikhedanasarvabuddhabodhisattvaprattyekabuddhāryaśrāvakadharmabhāna-kamātāpitrgurudaksinīyatamondhakāravidhamanatailadhrtatrnolkāpradīpanānāgandhatailapradīpa-sarvākāravaropetaprāsādikatathāgatapratimākāranaksīrapratibhāsaratnottīrnakośapratimandanaparasattva-bodhacittāmukhīkaranakuśalasambhāraviśesa).

Disebut sebagai Yang memiliki kekuatan besar (mahāsthāmaprāpta), karena diberkahi dengan kekuatan besar dari Narayana (mahānārāyanabalopeta), juga disebut sang Mahā Nārāyana (tvānmahānārāyana ityucyate).

Disebut sebagai sang Penghancur semua musuh (sarvaparapramardaka), karena diberkahi dengan kekuatan untuk menaklukkan banyak jutaan mara (kotīśatamāradharsanabalopeta).

Disebut sebagai Yang memiliki sepuluh kekuatan Tathāgata (daśatathāgatabalopeta), karena memiliki daśabala dari para Tathāgata.

"Disebut sebagai Yang mengetahui ketepatan (sthānaj˝ānabalopeta), karena terampil dalam mengetahui apa yang tepat dan tidak tepat, telah meninggalkan kendaraan yang rendah dan kecil dan memiliki kekuatan untuk mencapai kualitas dari Mahāyāna, dan mengerahkan tenaga-Nya yang tidak habis-habisnya (sthānāsthānaj˝ānakuśalahīnaprādeśikayānavivarjanamahāyānagunasamudānayanabalopetātrptabalaprayoga),

"Disebut sebagai Yang memiliki kekuatan yang berasal dari mengetahui penyebab dan akibat dari semua tindakan di masa lalu, sekarang, dan masa depan (atītānāgatapratyutpannasarvakarmasamādānahetuvipākaj˝ānabalopeta), karena memiliki kekuatan yang berasal dari mengetahui penyebab dan akibat dari semua tindakan di masa lalu, sekarang, dan masa depan (atītānāgatapratyutpannakarmasamādānahetuśovipākaśoj˝ānabalopeta).

"Disebut sebagai Yang memiliki kekuatan untuk mengetahui kemampuan, tingkat ketekunan, dan indera semua makhluk (sarvasattvendriyavīryavimātratāj˝ānabalopeta), karena memiliki kekuatan untuk mengetahui kemampuan, tingkat ketekunan, dan indera semua makhluk.

"Disebut sebagai Yang memiliki kekuatan untuk mengetahui bagaimana cara memasuki berbagai jenis dunia (anekadhātunānādhātulokapraveśaj˝ānabalopeta), karena memiliki kekuatan untuk mengetahui bagaimana cara memasuki berbagai jenis dunia.

"Disebut sebagai Yang memiliki kekuatan untuk mengetahui apa yang membebaskan berbagai macam kecenderungan, banyak kecenderungan, dan semua kecenderungan (anekādhimuktinānādhimuktisarvaniravaśesādhimuktij˝ānabalopeta), karena memiliki kekuatan untuk mengetahui apa yang membebaskan berbagai macam kecenderungan, banyak kecenderungan, dan semua kecenderungan.

"Disebut sebagai Yang memiliki kekuatan untuk mengetahui Jalan yang menuntun ke semua (sarvatragāminīpratipajj˝ānabalopeta), karena memiliki kekuatan untuk mengetahui Jalan yang menuntun ke semua.

"Disebut sebagai Yang memiliki kekuatan untuk mengetahui semua perenungan meditasi, pembebasan, konsentrasi, dan penyerapan, serta cara memurnikan dan menghentikan emosi yang mengganggu (sarvadhyānavimoksasamādhisamāpattisamkleśavyavadānavyavasthāpanaj˝ānabalopeta), karena memiliki kekuatan untuk mengetahui semua perenungan meditasi, pembebasan, konsentrasi, dan penyerapan, serta cara memurnikan dan menghentikan emosi yang mengganggu .

"Disebut sebagai Yang memiliki kekuatan untuk mengetahui berbagai macam keberadaan masa lampau dengan tanpa kemelekatan (anekavidhapūrvanivāsānusmrtyāsangaj˝ānabalopeta), karena memiliki kekuatan untuk mengetahui berbagai macam keberadaan masa lampau dengan tanpa kemelekatan.

"Disebut sebagai Yang memiliki kekuatan pengetahuan yang berasal dari mata surga yang melihat jelas semua bentuk tanpa kecuali (niravaśesasarvarūpānāvaranadarśanadivyacaksurj˝ānabalopeta), karena memiliki kekuatan pengetahuan yang berasal dari mata surga yang melihat jelas semua bentuk tanpa kecuali.

"Disebut sebagai Yang memiliki kekuatan untuk mengetahui bagaimana semua kecenderungan kebiasaan terbentuk dan bagaimana semua keadaan yang kotor tanpa kecuali dilenyapkan (sarvamvāsanānusamdhigataniravaśesasarvāśravaksayaj˝ānabalopeta), karena memiliki kekuatan untuk mengetahui bagaimana semua kecenderungan kebiasaan terbentuk dan bagaimana semua keadaan yang kotor tanpa kecuali dilenyapkan.

"Disebut sebagai Yang telah mencapai pengumuman keyakinan pencapaian kebangkitan sempurna yang lengkap dari semua dharma tanpa kecuali; pengumuman keyakinan yang mengalahkan seluruh dunia, termasuk alam dewa (niravaśesasarvadharmābhisambuddhapratij˝ārohanasadevalokānabhibhūtapratij˝āvaiśāradyaprāpta), karena telah mencapai pengumuman pencapaian kebangkitan sempurna yang lengkap dari semua dharma tanpa kecuali; pengumuman yang mengalahkan seluruh dunia, termasuk alam dewa.

"Disebut sebagai Yang telah mencapai pengumuman keyakinan bahwa semua emosi yang mengganggu adalah hambatan untuk melampaui penderitaan,' dan dengan demikian menemukan keyakinan yang seluruh dunia, termasuk para dewa, tidak bisa menghancurkannya (sarvasāmkleśikāntarāyikadharmāntarāyakaranānirvānasyetitatpratij˝ārohanasadevake loke'nāchedyapratij˝āvaiśāradyaprāpta), karena telah mencapai pengumuman keyakinan bahwa semua emosi yang mengganggu adalah hambatan untuk melampaui penderitaan,' dan dengan demikian menemukan keyakinan yang seluruh dunia, termasuk para dewa, tidak bisa menghancurkannya.


Terakhir diubah oleh skipper tanggal Mon Feb 22, 2016 9:33 pm, total 5 kali diubah

skipper

Jumlah posting : 439
Join date : 27.11.08
Age : 28

Lihat profil user http://aryamahayana.forumup.com

Kembali Ke Atas Go down

Om Nama Sri Vajra Maha Kalaya

Post by skipper on Tue Feb 23, 2016 8:53 pm

"Disebut sebagai Yang telah mengumumkan bahwa 'melampaui penderitaan tercapai saat jalan penolakan duniawi terselesaikan,' dan telah mencapai keberanian yang seluruh dunia, termasuk para dewanya, tidak dapat menjungkirbalikkan (nairyānikīm pratipadam pratipadyamāno nirvānamārāgayisyatīti pratij˝ārohanasadevake loke'praticodyapratij˝āvaiśāradyaprāpta), karena telah mengumumkan bahwa 'melampaui penderitaan tercapai saat jalan penolakan duniawi terselesaikan,' dan telah mencapai keberanian yang seluruh dunia, termasuk para dewanya, tidak dapat membatalkan.

"Disebut sebagai Yang telah mencapai keberanian yang seluruh dunia termasuk para dewanya tidak dapat memundurkan, yang diungkapkan melalui pernyataan tentang pengetahuan dari cara meninggalkan semua kekotoran batin (savāśravaksayaj˝ānaprahānaj˝ānapratij˝ārohanasadevake loke'vivartyapratij˝āvaiśāradyaprāpta), karena telah mencapai keberanian yang seluruh dunia, termasuk para dewanya, tidak dapat memundurkan, yang diungkapkan melalui pernyataan tentang pengetahuan dari cara meninggalkan semua kekotoran batin.

"Disebut sebagai Yang mengajarkan Dharma tanpa gagap atau ragu (askhalitapadadharmadeśaka), karena telah mengajarkan Dharma tanpa gagap atau ragu.

"Disebut sebagai Yang menyimpan di dalam hati-Nya intisari dari Dharma, yang melampaui yang diucapkan atau yang didengar (arutānabhilāpyadharmasvabhāvānubuddha), karena menyimpan di dalam hati-Nya intisari dari Dharma, yang melampaui yang diucapkan atau yang didengar

"Disebut sebagai Yang melampaui penghentian (avirata), karena telah melampaui penghentian.

"Disebut sebagai Yang mampu memberkati suara yang tidak terhitung dari makhluk hidup dan mengubahnya ke dalam bahasa Dharma dari Buddha (sarvasattvarutāpramānabuddhadharmarutanirghosādhisthānasamartha), karena mampu memberkati suara yang tidak terhitung dari makhluk hidup dan mengubahnya ke dalam bahasa Dharma dari Buddha.

"Disebut sebagai Yang ingatan-Nya tidak pernah lupa (amusitasmrti), karena ingatan-Nya tidak pernah lupa.

"Disebut sebagai Yang penglihatan-Nya tidak terkaburkan oleh perbedaan (nānātvasamj˝āvigata), dan karena penglihatan-Nya tidak terkaburkan oleh perbedaan.

"Disebut sebagai Yang terkonsentrasi di seluruh pikiran-Nya dan di dalam semua serapan (sarvacittasamāhitasusamāhita), karena terkonsentrasi di seluruh pikiran-Nya dan di dalam semua serapan.

"Disebut sebagai Yang telah mengembangkan keseimbangan batin yang tidak membedakan (apratisamkhyāsamupeksaka), karena telah mengembangkan keseimbangan batin yang tidak membedakan.

"Disebut sebagai Yang tidak pernah kehilangan daya serap dalam pembentukan keyakinan (chradasamskārasamādhyaparihīna), karena tidak pernah kehilangan daya serap dalam pembentukan keyakinan.

"Disebut sebagai Yang tidak pernah kehilangan semangat ketekunan melalui penyerapan yang terkonsentrasi di dalam pembentukan semangat ketekunan (vīryasamskārasamādhyanāchedyāparihīnavīrya), karena tidak pernah kehilangan semangat ketekunan melalui penyerapan yang terkonsentrasi di dalam pembentukan semangat ketekunan.

"Disebut sebagai Yang perhatian kesadaran-Nya tidak pernah menghilang (aparihīnasmrti), karena tidak pernah kehilangan perhatian kesadaran (smrtyaparihīna).

"Disebut sebagai Yang kebijaksanaan-Nya tidak pernah menghilang (aparihīnapraj˝a), karena kebijaksanaan-Nya tidak pernah menghilang (aparihīnapraj˝a).

"Disebut sebagai Yang kebebasan-Nya tidak pernah menghilang (aparihīnavimukti), karena tidak pernah kehilangan kebebasan-Nya (vimuktyaparihīna).

"Disebut sebagai Yang penglihatan kebijaksanaan-Nya yang terbebaskan tidak pernah menghilang (aparihīnavimuktij˝ānadarśana), karena tidak pernah kehilangan penglihatan kebijaksanaan-Nya yang terbebaskan(vimuktij˝ānadarśanāprahīna).

"Disebut sebagai Yang melalui pengetahuan memberitahukan semua tindakan tubuh, ucapan, dan pikiran, serta memiliki pengetahuan yang dipandu oleh pengetahuan (sarvakāyakarmavākkarmamanaskarmaj˝ānapūrvamgamaj˝ānānuparivartisamanvāgata), karena melalui pengetahuan memberitahukan semua tindakan tubuh, ucapan, dan pikiran, serta memiliki pengetahuan yang dipandu oleh pengetahuan.

"Disebut sebagai Yang memiliki kebijaksanaan tanpa hambatan yang melihat masa lampau, masa depan, dan saat ini dengan tanpa kemelekatan (atītānāgatapratyutpannesvadhvasvasangāpratihataj˝ānadarśanasamanvāgata), karena memiliki kebijaksanaan tanpa hambatan yang melihat masa lampau, masa depan, dan saat ini dengan tanpa kemelekatan.

"Disebut sebagai Yang telah mencapai kebebasan yang tanpa noda (anāvaranavimoksapratilabdha), karena telah mencapai kebebasan yang tanpa noda.

"Disebut sebagai Yang terus-menerus terampil dalam mendorong kegiatan makhluk hidup (adhisthitasarvasattvacaritapraveśakauśalyāvasthita), karena terus-menerus terampil dalam mendorong kegiatan makhluk hidup.

"Disebut sebagai Yang terampil dalam mengajar Dharma kepada orang lain sesuai dengan kemampuan mereka (yathāpratyarhadharmadeśanākuśala), karena terampil dalam mengajar Dharma kepada orang lain sesuai dengan kemampuan mereka.

"Disebut sebagai Yang telah mencapai penyempurnaan mandala dari semua aspek suara yang merdu (sarvasvarāngamandalaparamapāramitāprāpta), dan karena telah mencapai penyempurnaan mandala dari semua aspek suara yang merdu.

"Disebut sebagai Yang suara-Nya sama seperti suara Dewa, Naga, Yaksa, Gandharva, Asura, Garuda, Kinnara, dan Mahoraga (devanāgayaksagandharvāsuragarudakinnaramahoragaruta), karena terampil dalam mengucapkan secara jelas semua suara dan gema (sarvarutapratirutaniścāranakauśalyaprāpta)

"Disebut sebagai Yang suara-Nya bergema sama seperti suara Brahma (brahmasvararutaravitanirghosa).

"Disebut sebagai Yang bersuara seperti suara burung kalavinka (kalavinkarutasvara).

"Disebut sebagai Yang bersuara seperti bunyi genderang yang besar (dundubhisamgītirutasvara).

"Disebut sebagai Yang bersuara seperti gema dari bumi (dharanītalanirnādanirghosasvara).

"Disebut sebagai Yang bersuara seperti suara gemuruh dari halilintar dari Penguasa Naga Sagara (sāgaranāgendrameghastanitagarjitaghosasvara).

"Disebut sebagai Yang bersuara seperti suara singa atau banteng (simhavrsabhitābhigarjitanirghosasvara).

"Disebut sebagai Yang suara-Nya memuaskan, karena sesuai dengan bahasa dari semua makhluk (sarvasattvarutaravitānucaranasamtosanasvara).

"Disebut sebagai Yang suara-Nya menyenangkan mandala para pendengar-Nya dengan tanpa hambatan atau rintangan (asangānāvaranasarvaparsanmandalābhirādhanasvara).

"Disebut sebagai Yang dengan satu suara bisa dipahami dalam semua bahasa (ekarutātsarvarutasamprāpanasvara).

"Disebut sebagai Yang dipuja oleh Penguasa Brahma (brahmendrapūjita).

"Disebut sebagai Yang disembah oleh Penguasa para dewa (devendrasatkrta).

"Disebut sebagai Yang disembah sujud oleh Penguasa Naga (nāgendranamaskrta).

"Disebut sebagai Yang wajah-Nya yang bulat ditatapi oleh Penguasa Yaksa (yaksendrāvalokitamukhamandala).

"Disebut sebagai Yang dipuji dengan lagu oleh Penguasa Gandharva (gandharvendropagīta).

"Disebut sebagai Yang ditatapi oleh Penguasa Raksasa, yang memandangi-Nya dengan mata yang cerah dan tidak berkedip (rāksasendraprasannendriyāninimisanayanasampreksita).

"Disebut sebagai Yang Penguasa Asura datang membungkuk (asurendrābhipranata).

"Disebut sebagai Yang tidak terluka oleh tatapan dari Penguasa Garuda (garudendrāvihimsāpreksita).

"Disebut sebagai Yang dipuji oleh Penguasa Kinnara (kinnarendrābhistuta).

"Disebut sebagai Yang dirindukan oleh Penguasa Mahoraga untuk dilihat (mahoragendrābhilasitadarśana).

"Disebut sebagai Yang sangat dihormati oleh Penguasa Manusia (manujendrābhisampūjita).

"Disebut sebagai Yang didukung oleh perkumpulan besar dari mereka yang layak (aharganasevita).

"Disebut sebagai Yang mendorong semua Bodhisattva, memberikan energi dan membuat Mereka bahagia (sarvabodhisattvasamādāyakasamuttejakasamhaprarsaka).

"Disebut sebagai Yang mengajarkan Dharma yang bebas dari keduniawian (nirāmisadharmadeśaka).

"Disebut sebagai sang Guru terhormat dari Dharma yang tidak pernah salah dalam kata atau huruf (aksunnapadavya˝janāvandhyadharmadeśaka).

"Disebut sebagai Yang mengajarkan Dharma pada waktu yang tepat (kālānatikramanadharmadeśaka).

"Ini, Maitreya, pemutaran Roda Dharma hanyalah ajaran singkat yang memuji hanya beberapa kualitas dari sang Tathāgata. Lagi, Maitreya, untuk menerangkannya secara terperinci, sang Tathāgata akan membutuhkan waktu kalpa, beberapa waktu kalpa atau lebih dan masih itu tidak akan cukup untuk menerangkannya semua."

Maka pada saat itu sang Bhagavān berbicara syair-gāthā ini:

"Yang mendalam, sulit dilihat, dan halus (gambhīram durdrśam sūksmam),
Roda Dharma itu telah berputar (dharmacakram pravartitam).
Ini mara tidak akan memahami semua (yatra mārā na gāhante sarve),
Juga kaum tīrthikāh (ca paratīrthikāh).

"Yang tidak menghuni dan tidak tunduk pada perluasan (anālayam nisprapa˝cam),
Yang tidak terlahir dan tanpa asal mula (anutpādamasambhavam),
Yang unik dan kosong oleh sifat alami (viviktam prakrtīśūnyam).
Roda Dharma itu telah berputar (dharmacakram pravartitam).

"Tanpa menerima dan tanpa menolak (anāyūhamaniryūham),
Tanpa sebab dan tanpa tanda (animittamalaksanam),
Yang mengajarkan Dharma kesamaan (samatādharmanirdeśam),
Roda itu oleh sang Buddha telah diputar (cakram buddhena varnitam).

"Ilusi, khayalan udara (māyāmarīci),
Mimpi, juga gema, bulan yang tercermin di air (svapnam ca dakacandra pratiśrutkā),
Yaitu Roda yang seperti itu (yathaite tathā taccakram),
Oleh sang Pelindung Dunia telah diputar (lokanāthena vartitam).

"Ini menyebabkan melampaui gejala kejadian yang berkondisi (pratītyadharmaotāram);
Ini tidak dapat dihancurkan dan juga tidak abadi (anucchedamaśāśvatam),
Tapi memusnahkan semua pandangan (sarvadrstisamucchedo)
Roda Dharma yang demikian itu diajarkan (dharmacakramiti smrtam).

"Sungguh sama dengan ruang angkasa (ākāśena sadā tulyam),
Tanpa gagasan yang membeda-bedakan, bercahaya (nirvikalpam prabhāsvaram),
Petunjuk ini adalah yang tidak terbatas luasnya (anantamadhyanirdeśam),
Itulah yang dinamakan sebagai Roda Dharma (dharmacakramihocyate).

"Ini bebas dari keberadaan dan ketidakberadaan (astināstivinirmuktam),
Melampaui diri dan tiada diri (ātmyanairātmyavarjitam),
Ajaran yang secara alami tidak dilahirkan (prakrtyājātinirdeśam),
Itulah yang dinamakan sebagai Roda Dharma (dharmacakramihocyate).

"Ini adalah akhir dari yang terakhir, namun tanpa akhir (bhūtakotīmakotīm),
Kebenaran yang sungguh apa adanya (tathatāyām tathatvatah),
Petunjuk Dharma yang tidak mendua ini (advayo dharmanirdeśo),
Itulah yang dinamakan sebagai Roda Dharma (dharmacakram nirucyate).

"Mata sifat alaminya adalah kosong (caksuh svabhāvatah śūnyam),
Telinga, hidung, demikian juga (śrotam ghrānam tathaiva ca),
Lidah, tubuh, dan juga pikiran (jihvā kāyam ca cittam),
Juga kosong dan tidak berdaya (ca śūnyātmāno nirīhakah).

"Roda yang seperti itu adalah (idam tadīddaśam cakram),
Roda Dharma yang telah diputar (dharmacakram pravartitam).
Membangunkan makhluk yang belum terbangun (bodhayatyabudhān sattvāmstena);
Itulah yang dinamakan sebagai Kebangkitan (buddho nirucyate).

"Oleh Diri Sendiri telah menyadari sifat alami ini (svayam mayānubuddho'yam),
Sifat alami yang ditandai sebagai Dharma (svabhāvo dharmalaksanam),
Tanpa petunjuk dari orang lain (rte paropadeśena).
Saya adalah yang muncul dengan sendirinya, memiliki mata kebijaksanaan (svayambhūstatha caksumān).

"Yang menguasai semua Dharma (sarvadharmavaśiprāpto),
Itulah yang dinamakan sang Penguasa Dharma (dharmasvāmī nirucyate).
Yang mengetahui Dharma yang asli dari yang salah (nayānayaj˝o dharmesu),
Itulah yang dinamakan sebagai sang Pemandu (nāyakastena cocyate).

"Sebanyak para makhluk yang ada untuk dibimbing (yathā bhavanti vaineyā),
Para makhluk yang banyaknya tidak terbatas itu Saya bimbing (vinayāmyamitām janām).
Saya telah menyempurnakan pelatihan (vineyapāramiprāptastena),
Jadi disebut sang Pemandu Sempurna (prokto vināyakah).

"Makhluk yang telah menyimpang dari Jalan (nastamārgā hi ye sattvā),
Jalan yang Saya tunjukkan adalah yang tertinggi (mārgam deśemi uttamam).
Yang membimbing mereka ke pantai seberang (nayāmi pārimam tīram),
Dan oleh karena itu Sayalah sang Pemandu Sempurna (tasmādasmi vināyakah).

"Dengan mengetahui jalan untuk menarik (samgrahāvastuj˝ānena),
Saya mengumpulkan para makhluk (samgrhya janatāmaham).
Karena menyelamatkan para makhluk dari gurun samsara (samsārātavinistīrnah),
Pemimpin mereka adalah Saya (sārthavāhastato hyaham).

"Dengan menguasai semua gejala kejadian (vaśavartī sarvadharmesu),
Jadi Sayalah sang Pemenang, sang Penguasa Dharma (tena dharmeśvaro jinah).
Dengan memutar Roda Dharma (dharmacakram pravartitvā),
Itulah yang dinamakan sebagai Raja Dharma (dharmarājo nirucyate).

"Sayalah sang Raja Dermawan Dharma, sang Guru (dharmadānapatih śāstā),
Sang Penguasa Dharma yang tiada tandingan (dharmasvāmī niruttarah).
Persembahan dilakukan dengan baik dan tujuan tercapai (suyastayaj˝asiddhārthah);
Tersempurnakan dan kebajikan tercapai (pūrnāśah siddhamangalah).

"Sayalah yang menghibur, yang memberikan kenyamanan (āśvāsakah ksemadarśī),
Sang Pahlawan yang telah menaklukkan penderitaan besar (śūro mahāranamjahah).
Sang Pemenang di semua pertempuran (uttīrnasarvasamgrāmo),
Yang telah terbebaskan dan membebaskan para makhluk (mukto mocayitā prajāh).

"Sayalah sang Cahaya terang dunia (ālokabhūto lokasya).
Yang menyebarkan cahaya kebijaksanaan pengetahuan (praj˝āj˝ānaprabhamkarah),
Menaklukkan kegelapan kebodohan (aj˝ānatamaso hantā).
Sayalah sang Pemegang obor; sang cahaya besar (ulkādhāri mahāprabham).

"Sayalah sang Penyembuh besar dengan pengetahuan besar (mahāvaidyo mahāj˝ānī),
Sang Penyembuh kekotoran betin yang besar (mahākleśacikitsakah).
Untuk semua makhluk yang menderita kekotoran batin (sattvānām kleśaviddhānām),
Sayalah sang Pencabut duri penderitaan yang tiada tandingan (śalyahartā niruttarah).

"Semua tanda-tanda telah lengkap (sarvalaksanasampannah),
Semua tanda dari kebaikan menghiasi dengan indah (sarvavya˝janaśobhitah).
Dengan tubuh Samantabhadra ini (samantabhadrakāyena),
Menyesuaikan dengan cara kehidupan yang rendah (hīnānām cānuvartakah).

"Saya kuat dengan sepuluh kekuatan (daśabhirbalabhirbalavān),
Sang Ahli bijaksana yang mutlak sempurna (vaiśāradyaviśāradah),
Sang Pemilik delapan belas kualitas yang unik (āvenikairastadaśai),
Sang Maha Muni dari kendaraan tertinggi (agrayānī mahāmunih).

"Demikian Penjelasan yang singkat ini (esa samksepanirdeśo)
Yang memutar Roda Dharma (dharmacakrapravartane),
Yang menjelaskan kualitas kebajikan dari sang Tathāgatā (tathāgatagunavarnah),
Secara terbatas telah diperlihatkan (parītto'yam prakāśitah).

"Karena pengetahuan dari sang Buddha adalah tidak terbatas (buddhaj˝ānamanantam)
Sama dengan luasnya ruang angkasa (hi ākāśavipulam samam).
Bahkan jika orang harus berbicara dalam waktu kalpa (ksapayetkalpa bhāsanto),
Juga tidak akan kehabisan kualitas dari sang Buddha (na ca buddhagunaksayah)."

Demikianlah Sri Lalitavistara Bagian kedua puluh enam tentang Memutar Roda Dharma.
(iti śrīlalitavistare dharmacakrapravartanaparivarto nāma sadvimśatitamo'dhyāyah)



Terakhir diubah oleh skipper tanggal Wed Feb 24, 2016 8:31 pm, total 1 kali diubah

skipper

Jumlah posting : 439
Join date : 27.11.08
Age : 28

Lihat profil user http://aryamahayana.forumup.com

Kembali Ke Atas Go down

Om Ah Hum

Post by skipper on Tue Feb 23, 2016 9:02 pm


HRIH


Om A mi de va Hrīh



Om A mo gha si ddhi āh Hūm
nigamaparivartah saptavimśah
Bab 27 - Ajaran

Kemudian para devaputrā, yang telah meminta ajaran Dharmaparyāya ini dari sang Tathāgata, yaitu Maheśvara, Nanda, Sunanda, Candana, Mahita, Santa, Prasanta, dan Vinīteśvara yang memimpin lebih dari delapan belas ribu devaputra dari alam śuddhāvāsa, kini berkumpul pada pemutaran Roda Dharma dari sang Tathāgata. Pada saat itu sang Tathāgata menyapa Maheśvara devaputra yang memimpin para devaputra dari alam śuddhāvāsa, dengan cara sebagai berikut:

"Dengan cara ini, 'Mārsā (Orang mulia)', Sutra Dharmaparyāya yang bernama Lalitavistara ini adalah kegiatan permainan Bodhisattva yang sangat luas (lalitavistaro nāma dharmaparyāyasūtrānto mahāvaipulyabodhisattvavikrīditah), merupakan pintu masuk permainan di wilayah Buddha (buddhavisaye lalitapraveśa). Untuk memperkenalkan Diri-Nya Sendiri, sang Tathāgata telah menceritakannya (ātmopanāyikastathāgatena bhāsitah). Jadi sekarang Anda harus menyerapnya, melestarikannya, dan menyebabkannya diceritakan kembali. Dengan cara ini, 'bimbingan Dharma (dharmanetrī)' Saya ini akan menyebar.

"Ketika para pengikut Kendaraan Bodhisattva (bodhisattvayānikāśca pudgalā) mendengar Dharmaparyāya ini, mereka akan mengembangkan ketekunan yang sangat teguh (drdhataram vīryamālapsyante). Para makhluk yang mengembangkan keyakinan yang kuat untuk mencapai Anuttarā Samyaksambodhā akan mengembangkan kekuatan yang menurunkan hujan Dharma yang besar (mahādharmavarsavegam samjānayisyanti). Māra akan dihancurkan. Semua yang memberitakan ajaran yang berbeda tidak akan membuat kemunculan mereka. Permintaan Anda untuk mengajarkan Dharma ini akan menjadi akar kebajikan (yusmākam ca taddharmadeśanādhyesanā kuśalamūlam), sangat berharga (mahārthikam), buah yang besar (mahāphalam), dan pujian yang besar (mahānuśamsam).

"Siapa pun, Mārsā, yang telapak tangannya beranjali kepada pengajaran Lalitavistara Dharmaparyāya, 'delapan ciri terunggul (astāvutkrstān dharmān)' akan diperoleh. Apa delapan ini? Yaitu : Bentuk terunggul diperoleh (utkrsta rūpam pratilapsyate), kekuatan terunggul diperoleh (utkrstabalam pratilapsyate), rombongan penggiring terunggul diperoleh (utkrstaparivāram pratilapsyate), kefasihan bicara terunggul diperoleh (utkrstapratibhānam pratilapsyate), penolakan terunggul diperoleh (utkrstanaiskramyam pratilapsyate), kemurnian pikiran terunggul diperoleh (utkrstacittapariśuddhim pratilapsyate), tingkat pemusatan pikiran terunggul diperoleh (utkrstasamādhipadam pratilapsyate), kemunculan kebijaksanaan terunggul diperoleh (utkrstapraj˝āvabhāsam pratilapsyate). Ini adalah delapan ciri terunggul yang diperoleh (imānyastāvutkrstān dharmān pratilapsyate).

"Siapa pun, Mārsā, yang mendirikan 'takhta Dharma (dharmāsanam)' kepada Guru Dharma yang mengajarkan Lalitavistara Dharmaparyāya ini akan mendapatkan delapan takhta yang diinginkan segera setelah takhta itu didirikan. Apa delapan ini? Yaitu : Takhta terunggul didapatkan (śresthyāsanapratilambhah), takhta perumah tangga didapatkan (grhapatyāsanapratilambhah), takhta Pemutar Roda didapatkan (cakravartyāsanapratilambhah), takhta Pelindung Dunia didapatkan (lokapālāsanapratilambhah), takhta Sakra didapatkan (śakrāsanapratilambhah), takhta Vaśavarti didapatkan (vaśavartyāsanapratilambhah), takhta Brahma didapatkan (brahmāsanapratilambhah), kursi kebangkitan yang tertinggi dan terunggul, sang takhta singa dari Bodhisattva yang telah mencapai intisari tertinggi dan yang berhasil menghancurkan serangan Māra menjadi didapatkan (bodhimandavarāgragatasya bodhisattvabhūtasyāpratyudāvartyanihatamārapratyarthikasimhāsanapratilambhah), yang membangkitkan Kebuddhaan yang tanpa tandingan, yang sempurna dan yang lengkap, sang takhta Pemutaran Roda Dharma yang tiada tandingan yang diinginkan menjadi didapatkan (anuttarāsamyaksambodhimabhisambuddhasya ato'nuttaradharmacakrapravartanāsanapratilambhaśca pratikānksitavyah). Ini adalah delapan takhta yang diinginkan yang didapatkan (ime'stāvāsanapratilambhāh pratikānksitavyāh).

"Siapa pun, Mārsā, yang memuji Guru Dharma yang mengajarkan Lalitavistara Dharmaparyāya ini akan memperoleh delapan kemurnian berbicara (so'stau vākpariśuddhīh pratilapsyate). Apa delapan ini? Yaitu : Dengan tindakan murni dari ucapan yang selaras dengan kebenaran (satyānuparivartivākkarmapariśuddhyā), orang lain akan melakukan sesuai yang dikatakan (yathāvāditathākāritām). Dengan menguasai pendengar (parsadabhibhavanatayā), kata-kata akan diterima (ādeyavacanatām). Dengan tidak diabaikan (anuddhuratayā), kata-kata akan diperhatikan (grāhyavacanatām). Dengan damai mengumpulkan makhluk (apārusyasattvasamgrahanatayā), berbicara ramah dan lembut (ślaksnamadhuravacanatām). Dengan memuaskan tubuh dan pikiran (kāyacittodbilyakaranatayā), suara akan menjadi seperti suara burung kalavinka (kalavinkarutasvaratām). Dengan menguasai semua makhluk (sarvasattvairanabhibhavanatayā), akan memiliki suara orang (taduktavacanatām). Dengan menguasai semua suara (sarvasvarābhibhavanatayā), akan memiliki suara seperti Brahmā (brahmasvaratām). Dengan tidak dikuasai oleh semua suara yang lain (sarvaparapravādibhiranabhibhavanatayā), akan memiliki suara seperti suara auman singa (simhaghosābhigarjitasvaratām). Dengan memuaskan indera semua makhluk (sarvasattvendriyaparitosanatayā), akan memiliki suara Buddha (buddhasvaratām). Ini adalah delapan kemurnian berbicara yang diperoleh (imā astau vākkarmapariśuddhīh pratilapsyate).

"Siapa pun, Mārsā, yang pada pengajaran Lalitavistara Dharmaparyāya ini 'menulisnya menjadi buku (pustakalikhitam)', dan membawanya (dhārayisyati), memuliakannya (satkarisyati), menyembahnya (gurukarisyati), menghormatinya (mānayisyati), dan memujanya (pūjayisyati) sementara sedang memuji Dharmaparyāya ini dalam empat penjuru arah tanpa perasaan kikir, dengan mengatakan, 'Kemarilah (āgacchatemam) ! Tulislah Dharmaparyāya ini (dharmaparyāyam likhitam) ! Bawalah (dhārayata)! Bacakanlah (vācayata)! Renungkanlah (cintayata)! Ulangilah membacanya (svādhyāyateti)! "Dia akan mencapai delapan harta (astau mahānidhānāni). Apa delapan harta ini? Yaitu : harta ingatan yang tidak pernah gagal dan tidak lupa (smrtinidhānam asammosanatayā), harta kecerdasan oleh analisis yang cermat (matinidhānam buddhiprabhedanatayā), harta kesadaran dengan semangat memahami arti dari semua sutra (gatinidhānam sarvasūtrāntārthagatyanurāgatayā), harta menghafal dengan mengingat semua yang di dengar (dhāranīnidhānam sarvaśrutādhāranatayā), harta kefasihan berbicara diperoleh melalui memuaskan semua makhluk hidup dengan nasihat yang baik (pratibhānanidhānam pratilabhate sarvasattvasubhāsitasambhāsanatayā), harta Dharma diperoleh melalui melestarikan Dharma sejati (dharmanidhānam pratilabhate saddharmapratilaksanatayā), harta pikiran kebangkitan dengan mempertahankan garis keturunan dari Tiga Permata (bodhicittanidhānam triratnavamśānupacchedanatayā), dan harta pencapaian dengan mengembangkan daya tahan terhadap gejala kejadian yang tidak dilahirkan (pratipattinidhānam cānutpattikadharmaksāntipratilambhatayā) menjadi diperoleh. Ini adalah delapan harta yang diperoleh (imānyastau nidhānāni pratilapsyate).

"Siapa pun, Mārsā, yang mengajarkan Lalitavistara Dharmaparyāya ini dan menjelaskannya, akan menyempurnakan 'delapan kekayaan (so'stau sambhārān)'. Apa delapan ini? Yaitu : kekayaan kedermawanan dicapai dengan menjadi bebas dari kekikiran (dānasambhāram paripūrayisyati amātsaryacittatayā), kekayaan disiplin dicapai dengan menyempurnakan semua tujuan yang penuh kebajikan (śīlasambhāram paripūrayisyati sarvakalyānābhiprāyaparipūranatayā), kekayaan belajar dicapai dengan melakukan kebijaksanaan yang tidak terikat (śrutasambhāram paripūrayisyati asangapraj˝āsamudānayanatayā), kekayaan keheningan yang tenang dicapai melalui melaksanakan semua keadaan meditasi dan keseimbangan (śamathasambhāram paripūrayisyati sarvasamādhisamāpattyāmukhīkaranatayā), kekayaan wawasan dicapai melalui menyempurnakan pengetahuan dengan cara tiga pengetahuan (vidarśanāsambhāram paripūrayisyati traividyavidyāpratipūryā), kekayaan pahala kebajikan dicapai dengan memurnikan tanda dan tanda pelengkap dan hiasan dari alam Buddha (punyasambhāram paripūrayisyati laksanānuvya˝janabuddhaksetrālamkāraviśuddhyā), kekayaan pengetahuan tinggi dicapai dengan memuaskan kecenderungan dari semua makhluk (j˝ānasambhāram paripūrayisyati sarvasattvayathādhimuktisamtosanatayā), dan kekayaan kasih sayang yang besar dicapai dengan tidak pernah lelah untuk mematangkan semua makhluk (mahākarunā sambhāram paripūrayisyati sarvasattvaparipācanāparikhedatayā). Ini adalah delapan kekayaan yang dicapai (imānastau sambhārān paripūrayisyati).

"Siapa pun, Mārsā, yang mengajarkan Lalitavistara Dharmaparyāya ini dengan lengkap, memiliki pandangan ini dan berpikir bahwa makhluk hidup lainnya harus menerima Dharmā ini, akan mencapai kumpulan akar kebajikan dari delapan pahala kebajikan yang besar (kuśalamūlenāstau mahāpunyatāh). Apa delapan ini? Yaitu : Menjadi Raja Pemutar Roda, adalah yang pertama dari pahala kebajikan besar ini (rājā bhavati cakravartī, iyam prathamā mahāpunyatā). Menyebabkan menjadi penguasa tertinggi para dewa di surga Empat Raja Besar, adalah yang kedua dari pahala kebajikan besar ini (caturmahārājakāyikānām devānāmādhipatyam kārayisyati, iyam dvitīyā mahāpunyatā). Menjadi Sakra sang raja para dewa, adalah yang ketiga dari pahala kebajikan besar ini (śakro bhavisyati devendrah iyam trtīyā mahāpunyatā). Menjadi Dewaputra surga Suyama, adalah yang keempat dari pahala kebajikan besar ini (suyāmo bhavisyati devaputrah, iyam caturthī mahāpunyatā). Menjadi tinggal di surga Tusita, adalah yang kelima dari pahala kebajikan besar ini (samtusito bhavisyati, iyam pa˝camī mahāpunyatā). Menjadi tinggal di surga Nirmita, adalah yang keenam dari pahala kebajikan besar ini (sunirmito bhavisyati, iyam sasthī mahāpunyatā). Menjadi Raja Dewa di surga Paranirmitavaśavarti, adalah yang ketujuh dari pahala kebajikan besar ini (paranirmitavaśavartī bhavisyati devarājah, iyam saptamī mahāpunyatā). Menjadi Mahā Brahmā di surga brahmā, adalah yang kedelapan dari pahala kebajikan besar ini (brahmā bhavisyati mahābrahmā, iyam astamī mahāpunyatā). Akhirnya menjadi Tathāgato Arhan Samyaksambuddha, terbebas dari semua kondisi yang tidak menyenangkan (sarvākuśaladharmaprahīnah) dan memiliki semua kondisi yang menyenangkan (sarvakuśaladharmasamanvāgatah). Ini adalah delapan pahala kebajikan besar yang diperoleh (imā astau mahāpunyatāh pratilapsyate).

"Siapa pun, Mārsā, yang mendengarkan dengan penuh perhatian Lalitavistara Dharmaparyāya ini saat sedang dijelaskan akan memperoleh 'delapan keadaan pikiran yang bersih tanpa noda (so'stau cittanirmalatāh)'. Apa delapan ini? Yaitu : Cinta kasih diperoleh - menaklukkan semua kemarahan (maitrīm pratilapsyate sarvadosanirghātāya), kasih sayang diperoleh - menghilangkan semua sakit hati (karunām pratilapsyate sarvavihimsotsargāya), kegembiraan diperoleh - melenyapkan semua kemurungan (muditām pratilapsyate sarvāratyapakarsanatāyai), keseimbangan batin yang tenang diperoleh - menghilangkan nafsu keinginan dan kemarahan (upeksām pratilapsyate anunayapratighotsargāya), empat konsentrasi diperoleh - menguasai seluruh alam bentuk rupa (catvāri dhyānāni pratilapsyate sarvarūpadhātuvaśavartitāyai), empat keseimbangan tanpa bentuk diperoleh - menguasai pikiran (catasra ārūpyasamāpattīh pratilapsyate cittavaśavartitāyai), lima jenis pengetahuan yang lebih tinggi diperoleh - melakukan perjalanan ke alam Buddha lainnya (pa˝cābhij˝āh pratilapsyate anyabuddhaksetragamanatāyai), dan kemampuan untuk menaklukkan semua jejak dari kecenderungan kebiasaan diperoleh - mencapai Sūramgama Samādhi (sarvavāsanānusamdhisamuddhāram pratilapsyate śūramgamasamādhipratilambhāya). Ini adalah delapan keadaan pikiran yang bersih tanpa noda yang diperoleh (imā astau cittanirmalatāh pratilapsyate).

"Siapa pun, Mārsā, apakah di desa, kota, pasar, negara, wilayah negara, tempat berjalan, vihāra atau di mana pun Lalitavistara Dharmaparyāya ini ditemukan, delapan ketakutan ini tidak akan terwujud, menghentikan pematangan karma masa lampau. Apa delapan ini? Yaitu : masalah ketakutan yang disebabkan oleh penguasa tidak akan ada (rājasamksobhabhayam na bhavisyati), masalah ketakutan yang disebabkan oleh pencuri tidak akan ada (caurasamksobhabhayam na bhavisyati), masalah ketakutan yang disebabkan oleh penjahat tidak akan ada (vyālasamksobhabhayam na bhavisyati), masalah ketakutan yang disebabkan oleh kelaparan di padang gurun tidak akan ada (durbhiksakāntārasamksobhabhayam na bhavisyati), masalah ketakutan yang disebabkan oleh perkelahian, pertengkaran dan perselisihan tidak akan ada (anyonyakalahavivādavigrahasamksobhabhayam na bhavisyati), masalah ketakutan yang disebabkan oleh dewa tidak akan ada (devasamksobhabhayam na bhavisyati), masalah ketakutan yang disebabkan oleh naga tidak akan ada (nāgasamksobhabhayam na bhavisyati), masalah ketakutan yang disebabkan oleh yaksa tidak akan ada (yaksasamksobhabhayam na bhavisyati), dan masalah ketakutan yang disebabkan oleh semua jenis kemalangan tidak akan ada (sarvopadravasamksobhabhayam na bhavisyati). Jadi, Mārsā, delapan ketakutan ini tidak akan ada, menghentikan pematangan karma masa lampau (imāni mārsāstatrāstau bhayāni na bhavisyanti sthāpayitvā pūrvakarmavipākam).

"Kesimpulannya, Mārsā, bahkan jika umur dari sang Tathāgatah berlangsung selama satu kalpa, dan bahkan jika Dia akan memuji Dharmaparyāya ini tanpa terputus siang dan malam, tidak akan mampu mengakhiri pujian Dharmaparyāya ini, dan kefasihan pidato sang Tathāgata masih akan terus berlanjut.

"Kemudian juga, Mārsā, disiplin (śīla), penyerapan (samādhi), kebijaksanaan (praj˝ā), pembebasan (vimukti), dan penglihatan pengetahuan (j˝ānadarśana) dari sang Tathāgatah adalah tidak terukur dan tidak terbatas. Oleh karena itu, Mārsā, jika ada yang mengembangkan keinginan supaya orang lain menerima Dharmaparyāya ini, dan mengingatnya (udgrahīsyati), membawanya (dhārayisyati), membacanya (vācayisyati), menulisnya (likhisyati),
atau membuatnya ditulis (lekhayisyati), memahaminya (paryavāpsyati), mengerjakannya (pravartayisyati), dan kepada perkumpulan orang mengajarkannya dengan lengkap (parsanmadhye ca vistarena samprakāśayisyati), Dalam cara ini para makhluk yang memperoleh Dharma yang mulia ini, maka pahala kebajikan mereka juga akan tidak terbatas. "

Kemudian sang Bhagavān berbicara kepada Ayusma Mahākāśyapa, Ayusma Ananda, dan Bodhisattva Mahāsattva Maitreya : "Dengan demikian, Mārsā, Anuttarā Samyaksambodhi yang Saya telah capai melalui seratus ribu koti nayuta asamkhyeya kalpa, sekarang ditempatkan di tangan Anda, dipercayakan kepada Anda dengan pengambilalihan tertinggi. Anda sendiri harus menjaga dharmaparyāya ini dan mengajarkannya secara lengkap kepada orang lain. "

Ketika telah mengatakan ini, sang Bhagavān untuk menyampaikan Dharmaparyāya ini lebih lengkap mengucapkan syair-gāthā berikut :

"Jika makhluk yang Saya lihat dengan mata Buddha
Semuanya adalah Arhan yang sebanding dengan Sariputra,
Dan jika orang akan membuat pemujaan kepada Mereka selama jutaan kalpa,
Yang sama jumlahnya dengan butiran pasir di sungai Gangga,

"Jika ada orang membuat pemujaan kepada satu Pratyekabuddhā,
Bahkan hanya selama satu hari dan satu malam dengan gembira,
Dengan berbagai macam kalung karangan bunga dan sejenisnya,
Dari pahala kebajikan ini akan lebih jauh melampaui lagi.

"Jika semua makhluk adalah Pratyayairjinā,
Dan ada orang yang memuja dengan penuh hati-hati
Dengan bunga (puspa), wewangian (gandha), dan salep (vilepa)
Terus menerus selama banyak ratusan kalpā.

"Jika kepada satu Tathāgata
Membuat sujud tunggal disertai dengan sikap setia,
Dengan gembira berkata, 'Terpujilah sang Arahat (namo arhate)!'
Pahala kebajikan ini akan lebih jauh melampaui lagi.

"Jika semua makhluk adalah para Buddhā,
Dan ada orang memuja sama seperti yang sebelumnya,
Dengan bunga dari alam surga dan bunga yang paling berharga dari dunia ini,
Selama banyak kalpa dengan berbagai jenis persembahan,

"Jika pada jaman kemerosotan Saddharma,
Ada yang meninggalkan urusan tubuh dan hidupnya,
Membaca Sūtram ini selama satu hari dan satu malam,
Dari pahala kebajikan ini akan lebih jauh melampaui lagi.

"Siapapun yang ingin memuliakan sang Vināyakā,
Dan juga para Pratyekabuddhā dan para Srāvakā,
Harus menimbulkan Bodhicitta yang kukuh,
Dan selalu menjaga Sūtra ini secara tegas dalam kesadaran.

"Inilah Rājā dari semua nasihat yang baik
Yang diberikan oleh semua Tathāgatā.
Dimanapun permata Sūtra ini ditemukan,
Di tempat itulah sang Tathāgatā selalu berada.

"Mencapai kefasihan dan kebajikan yang tidak terbatas,
Membacanya hanya satu kata selama jutaan kalpa,
Tidak akan menyimpang dari kata-katanya atau maknanya,
Pada siapa pun yang memberikan Sutra ini kepada orang lain.

"Menjadi sang Pembimbing tiada tandingan,
Menjadi Makhluk yang tanpa bandingan,
Yang tidak habis-habisnya seperti lautan,
Adalah mereka yang mendengar Dharma ini dan mempraktekkannya."

Ketika sang Bhagavān mengucapkan kata-kata ini, Maheśvara devaputra bersama dengan para devaputrā dari śuddhāvāsakāyikā yang dipimpinnya, Maitreya bersama dengan semua Bodhisattvā Mahāsattvā yang dipimpinnya; Mahā Kāśyapa bersama dengan semua Mahā Srāvakāh yang dipimpinnya; dan semua dunia bersama dengan dewanya, manusianya, asuranya, dan gandharvanya bersukacita pada pidato sang Bhagavato.

Demikianlah Sri Lalitavistara Bagian kedua puluh tujuh tentang Ajaran.
(iti śrīlalitavistare nigamaparivarto nāma saptavimśatitamo'dhyāyah)

Telah Lengkap Bagian Dari Cara Kegiatan Semua Bodhisattva
(samāptam cedam sarvabodhisattvacaryāprasthānam)

Sang Raja Permata Sutra Mahayana Yang Bernama Sri Lalitavistara Telah Terselesaikan
(śrīlalitavistaro nāma mahāyānasūtram ratnarājam parisamāptam)

* * * * *

"Untuk asal mula penyebab gejala kejadian, sang Tathāgata telah menjelaskan penyebabnya (ye dharma hetuprabhavā hetum tesām tathāgato hyavadat)
serta cara menghentikannya, ini adalah Ucapan sang Maha Sramana (tesām ca yo nirodha evam vādī mahāśramanah)".


Terakhir diubah oleh skipper tanggal Sun Feb 28, 2016 9:43 am, total 2 kali diubah

skipper

Jumlah posting : 439
Join date : 27.11.08
Age : 28

Lihat profil user http://aryamahayana.forumup.com

Kembali Ke Atas Go down

Re: Arya Sri Lalitavistarah Maha Vaipulya Dharmaparyaya Suttram

Post by skipper on Fri Feb 26, 2016 10:56 pm


OM VAJRA PANI HUM

skipper

Jumlah posting : 439
Join date : 27.11.08
Age : 28

Lihat profil user http://aryamahayana.forumup.com

Kembali Ke Atas Go down

Re: Arya Sri Lalitavistarah Maha Vaipulya Dharmaparyaya Suttram

Post by Sponsored content Today at 7:15 am


Sponsored content


Kembali Ke Atas Go down

Halaman 2 dari 2 Previous  1, 2

Topik sebelumnya Topik selanjutnya Kembali Ke Atas


 
Permissions in this forum:
Anda tidak dapat menjawab topik